KEGG   Rhodobacter sphaeroides KD131: RSKD131_2680Help
Entry
RSKD131_2680      CDS       T00844                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain 1
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00630  Glyoxylate and dicarboxylate metabolism
rsk00710  Carbon fixation in photosynthetic organisms
rsk01100  Metabolic pathways
rsk01120  Microbial metabolism in diverse environments
rsk01200  Carbon metabolism
Module
rsk_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rsk_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rsk_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RSKD131_2680
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RSKD131_2680
Enzymes [BR:rsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RSKD131_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ACM02540
UniProt: B9KQ05
LinkDB All DBs
Structure
PDB: 

Position
1:complement(2722172..2722561)
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDAQISAQVDYCLGRGWAVSLEHTDDPHPRNTYWEMWGMPMFDLRD
PKGVMIELDECRKAWPGRYIRINAFDSTRGFETVTMSFIVNRPEVEPSLRMERTEVDGRS
IRYTHSIVR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggctgcttctcgttcctgcccgatctgaccgacgcgcagatctcg
gcgcaggtggactattgcctcggccgcggctgggccgtgagcctcgaacataccgacgac
ccgcatccccggaacacctactgggaaatgtggggcatgccgatgttcgacctgcgcgac
cccaagggcgtgatgatcgagctggacgagtgccgcaaggcctggcccggccgctacatc
cgcatcaatgccttcgattccacccgcggcttcgagacggtcacgatgagcttcatcgtc
aaccgccccgaggtcgagcccagcctccgcatggagcgcaccgaggtcgacggccggtcg
atccgctacacgcacagcatcgtccgctga

DBGET integrated database retrieval system