KEGG   Rhodobacter sphaeroides KD131: RSKD131_3350Help
Entry
RSKD131_3350      CDS       T00844                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00061  Fatty acid biosynthesis
rsk00780  Biotin metabolism
rsk01100  Metabolic pathways
rsk01130  Biosynthesis of antibiotics
rsk01212  Fatty acid metabolism
Module
rsk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RSKD131_3350
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RSKD131_3350
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    RSKD131_3350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rsk01004]
    RSKD131_3350
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RSKD131_3350
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RSKD131_3350
Lipid biosynthesis proteins [BR:rsk01004]
 Fatty acid synthase
  Component type
   RSKD131_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACM03210
UniProt: B9KWK6
LinkDB All DBs
Position
2:complement(256838..257626)
Genome map
AA seq 262 aa AA seqDB search
MADLMKGKRGLVMGVANDRSIAWGIARALAAEGAELAFSYQGEAFGKRVEPLAASVGSDF
LVDVDVMDDASLDACFGALKDRWGTLDFVVHAIAYSDKTELAGRFINTSRENFRNSLTIS
CYSFIDIARRASDLMPDGGALLTLTYQGSNRVTPYYNVMGVAKSALESAVRYLANDLGPQ
KIRVNAISPGPMKTLAGAAIAGARATFRHTEANAPLRANATLEAVGGTAAWLASDYGACT
TGEIVRVDGGYHVLGMPQPDHL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctgatgaagggtaaacgcggtctggtgatgggggtcgcgaacgaccgttcg
atcgcctggggcattgcacgcgccctggccgccgaaggggccgagctcgccttctcctat
cagggcgaggcgttcggcaagcgggtcgagccgctggcggcctcggtcggctcggacttt
ctcgtcgatgtcgacgtgatggacgatgcctcgctcgatgcttgcttcggcgcgctgaag
gaccgctggggcacgctcgacttcgtggtccatgccatcgcctattcggacaagaccgaa
ctcgccggacgcttcatcaacacctcgcgcgagaacttccgcaattcgctgacgatctcg
tgctattccttcatcgacatcgcgcggcgcgcctcggacctcatgcccgacggcggcgcg
ctgctgaccctgacctatcaggggtcgaaccgggtgacgccctattacaacgtgatgggc
gtggcgaaatcggcgctggaatcggcggtgcggtatctcgccaatgacctcgggccgcag
aagatccgggtgaatgcgatctcgcccggcccgatgaagacgctcgcgggggcggccatc
gcgggcgcacgcgccaccttccgccacaccgaggccaacgcgcccctgcgggcgaacgcg
acgctcgaagcggtgggcggcacggcggcttggctcgcctcggactatggcgcctgcacc
acgggcgagatcgtccgggtggacggcggctatcatgtgctggggatgccgcagcccgac
catctctga

DBGET integrated database retrieval system