KEGG   Ralstonia solanacearum PSI07: RPSI07_0354Help
Entry
RPSI07_0354       CDS       T01273                                 

Gene name
ldhA
Definition
(GenBank) fermentative D-lactate dehydrogenase, NAD-dependent
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_0354 (ldhA)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     RPSI07_0354 (ldhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C AdoHcyase_NAD 3HCDH_N ThiF
Motif
Other DBs
NCBI-ProteinID: CBJ49727
LinkDB All DBs
Position
complement(342380..343366)
Genome map
AA seq 328 aa AA seqDB search
MRILFFSSHRYDEDSFRAAQARSGHGFELVFQRAHLDVHTAPLAASFEVVCPFVNDCLDA
DVLAVLAAGGTRLIALRSAGFNHVDLAAAQRLGLTVARVPAYSPHAVAEHAVGMILTLNR
RLHRACNRTREGDFSLDGLLGFDLAGKTVGVVGTGQIGQVFARIMAGFGCRLLAFDPFPQ
AALGVTYVPLPTLLAQSDIVSLHCPLNADTHHLIDARALASMKMGAMLINTSRGGLIDSP
ALIDALKSGQLGHLGLDVYEEEADLFFEDRSADVLQDDVLARLLTFPNVIVTAHQAFFTR
EALAGIADTTLANAAAWAAGAPANVVNA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctcttcttcagcagccaccgttacgacgaagacagcttccgcgccgcgcag
gcgcgcagcggccacggcttcgaactggtcttccagcgcgcccacctggacgtgcacacc
gcgccgctggccgccagcttcgaggtggtctgcccgttcgtcaacgactgcctcgatgcc
gacgtgctcgccgtgctggccgccggcggcacccggctgatcgcgctgcgctcggctggc
ttcaaccatgtcgacctggccgcggcacagcggctggggctgacggtggcgcgggtgccg
gcgtattcgccgcatgcggtggccgagcacgcggtcggcatgatcctcacgctcaaccgg
cgcctgcaccgcgcctgcaaccgcacccgcgagggcgacttctcgctcgacgggctgctc
ggcttcgacctggccggcaagaccgtcggcgtggtcggcaccgggcagatcgggcaggtg
ttcgcgcgcatcatggccggcttcggctgccggctgctggcgtttgatccgtttccgcag
gcggcactgggcgtgacctacgtgccgctgccgactttgctggcgcagtccgacatcgtc
agcctgcactgcccgctcaatgccgacacgcaccacctgatcgacgcccgcgcgctcgcc
agcatgaagatgggcgccatgctgatcaacaccagccgcggcgggctgatcgacagcccc
gcgctgatcgacgcgctcaaatccggccagcttggccacctcgggctggacgtctatgag
gaagaggccgacctgttcttcgaagaccgctccgccgacgtgctgcaggacgacgtgctg
gcgcgcctgctgacctttcccaacgtcatcgtgaccgcgcaccaggcgttcttcacgcgc
gaggcgctggcgggcatcgccgacaccacgctcgccaacgcggcggcatgggcagccggc
gcgcccgcgaatgtggtgaacgcttaa

DBGET integrated database retrieval system