KEGG   Ralstonia solanacearum PSI07: RPSI07_0359Help
Entry
RPSI07_0359       CDS       T01273                                 

Gene name
aldA
Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_0359 (aldA)
   00620 Pyruvate metabolism
    RPSI07_0359 (aldA)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RPSI07_0359 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBJ49732
LinkDB All DBs
Position
347553..349073
Genome map
AA seq 506 aa AA seqDB search
MRYAHPGTPGAVVSFQSRYGNYIGGRFVPPLKGQYFTNTTPVTGEVIAEFPRSTAEDIDR
ALDAAHAAADAWGRTAVQDRSLILLKIADRIEQNLELLAVTETWDNGKPIRETLHADIPL
AVDHFRYFAGCIRAQEGAAAEINEHTMAYHIHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCIVLKPAEQTPLSICVLLELIGDLLPPGVLNVVHGFGKEAGEALATSKRLAKIAFTG
STPVGSHILKCAAENIIPSTVELGGKSPNIYFEDIMQAEPSFIEKAAEGLVLGFFNQGEV
CTCPSRALVQESIYGSFMDAVMAKVAAIKRGDPLDTETMVGAQASEQQFNKIRTYLEIAQ
EEGAECLVGGEAEVMSGKLANGYYIKPTLLKGDNSMRVFQEEIFGPVIAVTTFQDEAQAV
QIANDTEYGLGAGVWTRDINRAYRVGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRET
HKMMLDHYQQTKNLLVSYDTRPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgcccatcccggcacgcccggtgccgtggtttcgttccagtcgcgctacggc
aactacatcggcggccggttcgtgccgcccctcaaggggcagtacttcaccaacaccacg
ccggtgacgggcgaggtcatcgccgaattcccgcgctccaccgccgaggacatcgaccgt
gcgctcgacgccgcccacgccgcggccgacgcctggggccgcaccgcggtgcaggaccgt
tcgctgatcctgctgaagatcgctgaccgcatcgagcagaacctggagctgctggccgtg
accgagacctgggacaacggcaagccgatccgcgagacgctccatgccgatatcccgctg
gcggtggatcacttccgctacttcgccggctgcatccgcgcgcaggagggcgcggcggcg
gagatcaacgagcacaccatggcgtatcacatccatgaaccgctgggcgtggtcgggcag
atcattccgtggaacttcccgctgctgatggcggcgtggaagctggcgcccgcgctggcg
gccggcaactgcatcgtgctcaagcccgccgagcagacaccgctgagcatctgcgtgctg
ctggagctgatcggcgacctgctgccgccgggcgtgctcaacgtggtgcacggcttcggc
aaggaagccggcgaggcgctggccaccagcaagcgcctcgccaagatcgccttcacgggc
tcgacgccggtgggctcgcatatcctgaagtgcgcggccgagaacatcatcccgtcgacg
gtggagctgggcggcaagtcgcccaacatctacttcgaagacatcatgcaggccgagccg
agcttcatcgagaaggcggccgaagggctggtgctgggcttcttcaaccagggcgaggtg
tgcacgtgcccgtcgcgcgcgctggtgcaggagtcgatctacggcagcttcatggacgcg
gtgatggccaaggtggccgccatcaagcgtggcgacccgctcgacaccgagaccatggtc
ggcgcgcaggcctccgagcagcagttcaacaagatccgcacctacctggagatcgcgcag
gaagagggcgccgaatgcctggtcggcggcgaggccgaggtcatgtcgggcaagctggcc
aacggctactacatcaagccgacgctcctgaagggcgacaacagcatgcgcgtgttccag
gaagagatcttcggcccggtgatcgccgtgacgaccttccaggacgaggcgcaggccgtc
cagatcgccaacgacaccgagtacggcctgggcgcgggcgtgtggacgcgcgacatcaac
cgcgcctatcgcgtcggccgcgccatcaaggccggccgcgtgtggaccaactgctaccac
ctgtacccggcgcacgcggccttcggcggctacaagaaatcgggcgtgggccgcgagacc
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtgagctacgacacc
cggccgctcggctttttctga

DBGET integrated database retrieval system