KEGG   Ralstonia solanacearum PSI07: RPSI07_0622Help
Entry
RPSI07_0622       CDS       T01273                                 

Gene name
trpG
Definition
(GenBank) Anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsl00405  Phenazine biosynthesis
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01130  Biosynthesis of antibiotics
rsl01230  Biosynthesis of amino acids
rsl02024  Quorum sensing
Module
rsl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_0622 (trpG)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    RPSI07_0622 (trpG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RPSI07_0622 (trpG)
Enzymes [BR:rsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     RPSI07_0622 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: CBJ49987
LinkDB All DBs
Position
complement(610749..611318)
Genome map
AA seq 189 aa AA seqDB search
MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDDIETLNPARICISPGPCTPKEAG
ISVPLLERFAGRMPILGVCLGHQAIGDAFGGRVIRAQKVMHGKVSTIENTGAGVFANLPR
HFKVTRYHSLAIERETLPDCLEVTAWTDDGEIMGVRHKTLPVEGVQFHPESILSEHGHAL
LANFLKERA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgatgatcgacaactacgactccttcacctacaacctcgtccagtacttcggc
gagctcggcgaggacgtgcgcacctaccgcaacgacgagatcacgctcgacgacatcgag
acactgaacccggcccgcatctgcatctcgccggggccgtgcacgccgaaggaggcgggc
atctcggtgccgctgctggagcgcttcgcgggccgcatgcccatcctcggcgtgtgcctg
gggcaccaggccatcggggatgcgttcggcggacgggtgatccgcgcgcagaaggtgatg
cacggcaaggtcagcaccatcgagaacaccggcgcgggcgtattcgccaacctgccgcgc
catttcaaggtgacgcgctatcactcgctcgcgatcgagcgcgagacgctgcccgattgc
ctggaggtgaccgcctggaccgacgacggcgaaatcatgggcgtgcgccacaagacgctg
ccggtcgaaggcgtgcaattccaccccgaatcgatcctgtcggagcacggccacgccctg
ctggccaatttcctgaaggaacgcgcctga

DBGET integrated database retrieval system