KEGG   Ralstonia solanacearum PSI07: RPSI07_0638Help
Entry
RPSI07_0638       CDS       T01273                                 

Gene name
dppD
Definition
(GenBank) Dipeptide transport ATP-binding (ABC superfamily)
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RPSI07_0638 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsl02000]
    RPSI07_0638 (dppD)
Transporters [BR:rsl02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RPSI07_0638 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AIG1
Motif
Other DBs
NCBI-ProteinID: CBJ50002
LinkDB All DBs
Position
631277..632296
Genome map
AA seq 339 aa AA seqDB search
MTTPATSKPTLVVEGLKTEFTTRGGVARAVDDVSFTVGRGEIMGLVGESGSGKSMTGYSI
MGLIDPPGRVVGGRIELTGRDGVTHDLRTLSAGQMRDMRGNRIAMIFQDPMMTLNPVLRV
DTQMTEAVLAHQRVSRQQAREMAREALAKVGIPSPEERLQAYPHQFSGGMRQRVAIAIAL
LNKPDLIIADEPTTALDVTIQGQILAEVQTLCRESGTALIWITHDLSVVAGLADRVCVMY
AGRIVEQGSVQQVLETPRHPYTFGLIASAPSRNPRGVPLRQIPGMTPSLLALPSGCAFRE
RCAFATEVCKQTPLLESLDDGRALRCFHPVTQRPEEATA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccagccacttccaagccgacgctcgtcgtcgagggcctgaagaccgagttc
accacgcgtggcggtgttgcgcgggcggtcgatgacgtgtcgttcacggtcgggcgcggc
gagatcatgggcctggtcggcgagtccggctcgggcaagtcgatgaccggctattcaatc
atgggcctgatcgacccgcccgggcgcgtggtcggcgggcgcatcgagctgaccgggcgc
gatggcgtgacgcacgacctgcgcacgctgtcggccgggcagatgcgcgacatgcgcggc
aaccgcatcgccatgatcttccaggacccgatgatgacgctgaacccggtcctgcgtgtc
gatacgcagatgaccgaggcggtgctggcgcaccagcgcgtgagccggcagcaggcacgc
gagatggcgcgggaggcgctggccaaggtcggcatcccgtcgccggaggagcggctgcag
gcgtatccgcaccagttctcgggcggcatgcggcagcgggtggccatcgccattgcgttg
ctcaacaagccggacctgatcatcgccgacgagccgaccacggcgctggacgtgaccatc
cagggccagatcctggccgaggtgcagacgttgtgtcgcgagagcgggacggcgctgatc
tggatcacgcacgatctgtccgtggtggccggactggccgatcgcgtgtgcgtaatgtac
gccggccgcatcgtcgagcagggcagtgtgcagcaggtgctggaaacgccgcgccatccg
tacaccttcgggctgatcgcctcggcgccgtcgcgcaacccgcgtggcgtgccgctgcgg
cagatccccggcatgacgccgtcgctgctggcgctgcccagcggatgcgcgttccgcgag
cgctgtgcctttgccaccgaagtctgcaagcagacgcccttgctcgagtcgctcgatgac
ggccgtgcgctgcgctgcttccaccccgtgacccaacgccccgaggaggccaccgcatga

DBGET integrated database retrieval system