KEGG   Ralstonia solanacearum PSI07: RPSI07_0657Help
Entry
RPSI07_0657       CDS       T01273                                 

Gene name
ftsI
Definition
(GenBank) division-specific transpeptidase, penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00550  Peptidoglycan biosynthesis
rsl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RPSI07_0657 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RPSI07_0657 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsl01011]
    RPSI07_0657 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rsl03036]
    RPSI07_0657 (ftsI)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RPSI07_0657 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:rsl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   RPSI07_0657 (ftsI)
Chromosome and associated proteins [BR:rsl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    RPSI07_0657 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer IF2_N
Motif
Other DBs
NCBI-ProteinID: CBJ50020
LinkDB All DBs
Position
653390..655177
Genome map
AA seq 595 aa AA seqDB search
MSGAPKNPGTAARARLGQFSASPVLGLRLPMWRSKLVVFLMFAAFMALIGRALWIQGPGN
RFYEAEGKKRFQRTLELPATRGKILDRNGLVLATSLPVKAVWAVPEDVPNTVPGEDMQKL
AKLLGMSNKDLAGKLGEDKGFVYLKRQVLPDVADQIASLKIDGIYQTREYKRFYPEGEAM
AHIVGFTNVEDKGQEGMELAREPDLAGAPGQRQVIKDRLGRVVEDVGVLKAPREGRDMTL
SIDAKIQYLTFNELKAAVERNRAKAGSAIVLDAQTGEVLALANYPTYNPNDRTRLSGEQL
RNRVLTDTFEPGSMMKPITIGLALQLHRVTPNTLVQTNGKFTLDGATISDTSNYGTLTVG
QVIQHSSNIGTTKIALMLKPQEMWDMFTSVGFGQAPKIGFPGAVAGRLRPAKNWRRIEQA
TMSYGYGLSVSLFQMAHAYTIFAHDGELIPVTMYRTNGQPPQGERVLSPEVARQVRQMLE
TVTSPGGTAPQAQVMGYRVGGKTGTAYKHVGRGYDRSKYRASFIGLAPMSNPRIIVAVSV
DEPSAGSHYGGSVAGPVFASIAGGSLRALNVSPDSPVRQLVMTEGVAEEPVGALQ
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcacccaagaatcccgggacggcggcacgcgcccgcctgggccagttctcc
gccagcccggtgctggggctgcgcctgccgatgtggcgctccaagctggtggtcttcctg
atgttcgccgcgttcatggcgctgatcggccgtgcgctgtggatccagggcccgggtaac
cgcttctacgaggccgaaggcaagaagcgcttccagcgcacgctggagttgccggccacg
cgcggcaagattctcgaccgcaacggcctggtgctggccaccagcctgccggtcaaggcc
gtctgggccgtgccggaggacgtgcccaacaccgtgcccggtgaagacatgcagaagctc
gccaagctgctcggcatgagcaacaaggacctggcgggcaagctgggcgaggacaagggc
ttcgtctacctgaagcgccaggtgctgccggacgtcgccgaccagatcgccagcctgaag
atcgacggcatctatcagacgcgcgaatacaagcgcttctacccggaaggtgaggcgatg
gcgcacatcgttggcttcaccaacgtcgaggacaagggccaggaaggcatggaactggcg
cgcgagccggatctcgcgggtgcgcccggccagcgccaggtgatcaaggaccgcctgggc
cgcgtggtggaagacgtcggcgtgctgaaggcgccgcgcgagggccgcgacatgacgctc
tccatcgacgccaagatccagtacctgactttcaacgagctcaaggcggccgtggagcgc
aaccgtgccaaggccggcagcgccatcgtgctggacgcccagaccggcgaggtgctggcg
ctggccaactacccgacctacaacccgaacgaccgcacgcgcctgtcgggcgagcaactg
cgcaaccgcgtgctgaccgacaccttcgagcccggctcgatgatgaagccgatcacaatc
ggcctcgcgctgcagctgcatcgcgtgacgcccaatacgctggtgcagaccaacggcaag
ttcacgctggacggtgcgaccatctccgacaccagcaactatggcacgctgactgtcggc
caggtcatccagcactcgagcaacatcggcacgaccaagatcgcgctgatgctcaagccg
caggaaatgtgggacatgttcaccagcgtcggcttcggccaggcgcccaagatcggcttc
ccgggcgcggtggcagggcggctgcggccggccaagaactggaggcgcatcgaacaggcg
accatgtcgtacggctacggcctgtcggtgtcgctgttccagatggcacatgcctacacg
atcttcgcgcacgacggcgagctgatcccggtcacgatgtaccgcaccaacggccagccg
ccgcagggcgagcgcgtgctgtcgccggaggtggcgcggcaggtgcgccagatgctggag
accgtgacctcgcccggcggcaccgcaccgcaggcgcaggtgatgggctaccgcgtgggc
ggcaagaccggcacggcgtacaagcatgttggccgcgggtatgaccgctccaagtaccgt
gcgtcgttcatcggcctggcgcccatgtcgaacccgcgcatcatcgttgccgtcagcgtc
gacgagccttcggccggcagccattacggcggctcggtggccgggccggtgtttgcctcg
attgccggcggcagcctgcgtgccctgaacgtgtcgccggactcgccggtgcgccagctc
gtgatgaccgaaggcgtggccgaagaacccgtgggggcgttgcaatga

DBGET integrated database retrieval system