KEGG   Ralstonia solanacearum PSI07: RPSI07_0722Help
Entry
RPSI07_0722       CDS       T01273                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase (Acetyl-CoA carboxylase subunit A)
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_0722 (accC)
   00640 Propanoate metabolism
    RPSI07_0722 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_0722 (accC)
Enzymes [BR:rsl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RPSI07_0722 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RPSI07_0722 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: CBJ50085
LinkDB All DBs
Position
complement(724000..725367)
Genome map
AA seq 455 aa AA seqDB search
MFDKILIANRGEIALRIQRACRELGIKTVVVYSEADKEAKYVKLADEAVCIGPAPSPLSY
LNMPAIISAAEVTDAQAIHPGYGFLSENADFAERVEQSGFTFIGPTPECIRLMGDKVSAK
QAMIKSGVPCVPGSEGALPDDPKEILATARKVGYPVIIKAAGGGGGRGMRVVHTEAALLN
AVNMTREEAGRAFGNPEVYMEKFLEHPRHVEIQVLADQHRNAVWLGERDCSMQRRHQKVI
EEAPAPHIPRRLIERIGDRCADACKKIGYRGAGTFEFLYENGEFYFIEMNTRVQVEHPVT
EMITGVDIVQEQIRVAAGEKLRFRQKDIVLKGHAIECRINAEDPFKFTPSPGRITSWHVP
GGPGIRVDSHAYNGYFVPPNYDSMIGKVISYGATREQAIARMRIALSEMVVEGIQTNVPL
HRDLMLDANFVEGGTDIHYLEHRLEQQGVAKGGGK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaagatcctgatcgcgaatcgcggcgagatcgcgcttcgcatccagcgtgcc
tgccgcgaactcggcatcaagaccgtggtggtctattccgaggcggacaaggaagccaaa
tacgtcaagctggccgatgaagccgtctgtatcgggccggcgccgtcgccgctgtcgtac
ctgaacatgccggccatcatctcggcggcggaagtgaccgacgcccaggccatccacccc
ggctacggcttcctgtcggaaaacgccgactttgccgagcgcgtggagcaatccggcttc
accttcatcggcccgacccccgagtgcatccgcctgatgggcgacaaggtctcggccaag
caggccatgatcaagtccggcgtgccgtgcgtgccgggctcggaaggcgccctgccggac
gatccgaaggaaatcctggcaaccgcccgcaaggtcggctatccggtcatcatcaaggcg
gctggcggcggtggcggacgcggcatgcgcgtggtgcacaccgaggctgcgctgctcaac
gccgtcaatatgacgcgcgaagaggccggccgcgctttcggcaacccggaagtctatatg
gagaagttcctggagcatccgcgccacgtggagatccaggtcctggccgaccagcaccgc
aacgccgtctggctgggcgagcgcgactgctcgatgcagcgccgccaccagaaggtgatc
gaggaagcgccggcaccgcacatcccgcgccgcctgatcgagcgcatcggcgaccgctgc
gccgacgcctgcaagaagatcggctaccgtggcgccggcacgttcgagttcctgtacgag
aacggcgagttctatttcatcgaaatgaacacgcgcgtgcaggtcgagcacccggtcacg
gaaatgatcaccggcgtcgacatcgtgcaggagcagatccgcgtggctgccggcgagaag
ctccgcttccgccagaaggacatcgtcctgaagggccacgccatcgagtgccgcatcaac
gccgaagatccattcaagttcacgccgtcgccgggccgcatcacgtcgtggcacgtgccg
ggtggccccggcatccgcgtcgattcgcatgcgtacaacggctatttcgtgccgcccaac
tacgactcgatgatcggcaaggtcatctcctacggcgccacgcgcgagcaggccatcgcc
cgcatgcgcatcgctctgtcggaaatggtggtcgaaggcatccagaccaacgtgccgctg
caccgcgacctgatgctcgacgccaacttcgtcgaaggcggcaccgacatccactatctg
gaacatcgcctggaacagcagggcgtggccaagggcggcggcaagtga

KEGG   Ralstonia solanacearum PSI07: RPSI07_0723Help
Entry
RPSI07_0723       CDS       T01273                                 

Gene name
accB
Definition
(GenBank) Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_0723 (accB)
   00640 Propanoate metabolism
    RPSI07_0723 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_0723 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 RnfC_N YqfD HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: CBJ50086
LinkDB All DBs
Position
complement(725500..725967)
Genome map
AA seq 155 aa AA seqDB search
MDLRKLKTLIDLVAESGISELEVTEGEGKVRIVKSAPQVIAQPMQYAPMPVPTAPAMTAA
AAPAVAASAEAAAPALPAGHIVTSPMVGTFYRSPSPGAAAFVNVGDTVKEGQTICIIEAM
KLLNEIEADKGGVIKEVLVDNGQAVEYGQPLFVIG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcgcaagctgaaaacgctgatcgacctggtggccgaatcgggcatctcggag
ctcgaggtcaccgagggtgagggcaaggtccgcatcgtcaagtcggcgccgcaggtgatc
gcgcagccgatgcaatacgcgccgatgcccgtcccgaccgctccggcgatgaccgccgcc
gcagccccggccgtggccgccagcgcggaagccgccgccccggccctgccggccggccac
atcgtgacctcgccgatggtcggcacgttctatcgctcgccgtcgccgggtgccgcggcg
ttcgtcaacgtgggcgacaccgtcaaggaaggccagaccatctgcatcattgaagcgatg
aagctgctcaatgagatcgaagcggacaagggtggcgtgatcaaggaagtcctggtcgac
aacggccaagccgtcgaatacggccaaccgctgttcgtgatcggctga

KEGG   Ralstonia solanacearum PSI07: RPSI07_1449Help
Entry
RPSI07_1449       CDS       T01273                                 

Gene name
accD
Definition
(GenBank) Acetyl-CoA carboxylase carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_1449 (accD)
   00640 Propanoate metabolism
    RPSI07_1449 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_1449 (accD)
Enzymes [BR:rsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     RPSI07_1449 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RPSI07_1449 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC TF_Zn_Ribbon Tmemb_55A OrfB_Zn_ribbon Auto_anti-p27 Cys_rich_KTR DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: CBJ50810
LinkDB All DBs
Position
1483526..1484398
Genome map
AA seq 290 aa AA seqDB search
MSWLDKLLPPKIQQTDPSQRKGIPEGLWIKCPACESVLYRTDVEANLHVCPKCDHHMRIG
ARARLDAVLDAEGRYELGQEIVPVDALKFKDTKKYPDRIKAAMDDTGETDAMVVMGGAIH
ALPVVVACFEFEFMGGSMGSVVGERFVRGAQTALEQKVPFICVTATGGARMQESLLSLMQ
MAKTTAMVNKLAEARLPFISVLTDPTMGGVSASFAFMGDVVIAEPRALIGFAGPRVIEQT
VREKLPEGFQRAEFLLQKGAIDMIVDRRNMRREIAELLALLQKQPVDALA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctggacaaactgcttccgcccaagatccaacagaccgatccgtcgcaacgc
aagggcattccggaaggcctgtggatcaaatgccccgcctgcgagtcggtgctgtaccgt
accgacgtcgaagccaacctgcacgtctgccccaagtgcgaccaccacatgcgcatcggt
gcccgcgcgcgcctggatgcggtgctggacgccgagggccgctatgagctgggccaggag
atcgtcccggtcgacgccctcaagttcaaggacaccaagaagtaccccgaccgcatcaag
gcggccatggacgacaccggcgagaccgatgccatggtcgtgatgggcggtgccatccac
gcgctgccggtggtggtggcctgcttcgaattcgaattcatgggcggctcgatgggctcg
gtggtgggcgagcgcttcgtgcgcggcgcgcagaccgcgctggagcagaaggtgccgttc
atctgcgtgaccgccacgggtggcgcgcgcatgcaggaaagcctgctgtcgctgatgcag
atggccaagaccacggccatggtcaacaagctggccgaggccaggctgccgttcatcagc
gtgctgaccgatccgaccatgggcggggtgtccgccagcttcgccttcatgggcgacgtg
gtgatcgccgagccgcgtgccctgatcggctttgccggtccgcgcgtgatcgagcagacc
gtgcgcgagaagctgccggaaggtttccagcgcgccgagttcctgctgcagaagggcgcc
atcgacatgatcgtcgaccgccgcaacatgcgccgcgaaatcgctgaactgcttgcgctg
ctgcagaagcagccggtcgacgcgctggcctga

KEGG   Ralstonia solanacearum PSI07: RPSI07_2208Help
Entry
RPSI07_2208       CDS       T01273                                 

Gene name
accA
Definition
(GenBank) acetylCoA carboxylase, carboxytransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_2208 (accA)
   00640 Propanoate metabolism
    RPSI07_2208 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_2208 (accA)
Enzymes [BR:rsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     RPSI07_2208 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RPSI07_2208 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans baeRF_family3
Motif
Other DBs
NCBI-ProteinID: CBJ51573
LinkDB All DBs
Position
complement(2323067..2324035)
Genome map
AA seq 322 aa AA seqDB search
MKTTFLEFEQPIAELESKIEELRFVQDDSAVDISEEISRLAAKSQQLTKDLYANLSPWQV
AQIARHPQRPYTLDYVREIFTDFHELHGDRAFADDLSIVGGMARFNGQPCMVIGHQKGRD
TKERALRNFGMSKPEGYRKAKRLMELADKFGLPIFTFVDTPGAFPGIEAEERGQSEAIGH
NLFVMAGLKVPLIATIIGEGGSGGALAIAVGDAVLMLQFATYAVISPEGCASILWKTAEK
APEAAEALGLTAHRLKALSLIDKIVNEPLGGAHRDPKAMATMLKRALAESLRQFQGMKVS
ELQARRHERLMAYGKFKETGAN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccttcctggagttcgagcagccgatcgcagaacttgagtcgaagatcgaa
gaacttcgcttcgtgcaggacgattcggccgtcgacatttccgaagaaatctcccgcctg
gccgcgaaaagccagcagttgaccaaggacctgtatgccaacctgtcgccctggcaggtc
gcgcagatcgcacggcatccgcagcgtccgtacacgctggactacgtccgcgaaatcttc
accgacttccacgagctgcacggcgaccgcgcgttcgcggacgacctgtcgatcgtcggc
ggtatggcgcgcttcaatggccagccgtgcatggtgatcggccaccaaaagggccgcgac
accaaggagcgcgcactgcgcaatttcggcatgtccaagcccgagggctaccgcaaggcc
aagcgcctgatggagctggccgacaagttcggcctgccgatcttcaccttcgtcgacacg
ccgggcgcgttcccgggcatcgaggccgaggagcgcggccagtcggaggccatcggccac
aacctgttcgtgatggccggcctgaaagtgcccctgatcgccaccatcatcggcgagggc
ggttcgggcggtgcactggcgatcgccgtgggcgacgcggtgctgatgctgcagttcgcc
acctacgccgtgatctcgccggaaggctgcgcttccatcctgtggaagaccgccgagaag
gcgccggaagccgccgaggcgctgggtctgaccgcgcaccgtctcaaggcgctgagcctg
atcgacaagatcgtcaacgagccgctgggcggcgcgcaccgcgatccgaaggccatggcg
acgatgctcaagcgcgcgctggccgagtcgttgcgccagttccagggcatgaaggtgtcc
gagttgcaggcgcgccgccacgaacgcctgatggcctatggcaagttcaaggaaaccggc
gcgaactga

KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0637Help
Entry
RPSI07_mp0637     CDS       T01273                                 

Gene name
accB
Definition
(GenBank) biotin carboxyl carrier protein of acetyl-coa carboxylase (Bccp)
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_mp0637 (accB)
   00640 Propanoate metabolism
    RPSI07_mp0637 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_mp0637 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 BtpA RnfC_N V_ATPase_prox GCV_H
Motif
Other DBs
NCBI-ProteinID: CBJ34981
LinkDB All DBs
Position
mpPSI07:786251..786709
Genome map
AA seq 152 aa AA seqDB search
MDLSQIKQLIDAMASSDLAEMSFSHQGWVLRLVRHKSAAHRGDDVLPLADRAPLAPMPAH
HPPSPPAQSVPAAPKRRELLAPLFGVVHLQPAPGEPAFVQPGQTVQAGQTLCVIEAMKVF
NAVLAESDGTVDAVLVESGAEVEAGQPLIRFA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggacctttcgcagatcaagcagctcatcgatgccatggcgtcctcggaccttgccgag
atgagcttcagccatcagggatgggttctgagactggtgcggcacaagtcggctgcgcac
cgtggcgacgatgtcttgcccttggcggaccgtgcgccgctggcgcccatgcctgcgcac
cacccgccttctccaccggcgcagtcggttcccgccgcgccgaagcggcgtgaactgcta
gccccgctgtttggggtcgtgcacctgcagccagcgccgggtgaacctgcattcgtgcag
ccgggccagacggtacaggcgggacagaccctgtgcgtgatcgaagcgatgaaggtcttc
aacgcggtgctcgccgaaagcgacggcaccgtggacgctgtgctggtcgagtccggggcg
gaagtcgaggccggacagcctttgatccgattcgcgtga

KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0638Help
Entry
RPSI07_mp0638     CDS       T01273                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase (Acetyl-CoA carboxylase subunit A) (ACC)
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_mp0638 (accC)
   00640 Propanoate metabolism
    RPSI07_mp0638 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_mp0638 (accC)
Enzymes [BR:rsl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RPSI07_mp0638 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RPSI07_mp0638 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C LAL_C2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBJ34982
LinkDB All DBs
Position
mpPSI07:786706..788094
Genome map
AA seq 462 aa AA seqDB search
MSHRGFVMFDTVLIANRGEIALRIQRACRGLGLRTVAVYSEADRDAVYVRQADQALCIGP
ASPTASYLNQAALLAAARVSGAQAIHPGYGFLSENAGFVERVTDAGLTFIGPSAACIRTM
GDKVSAKRAMREAGVPCVPGPDTSLPEDPAAVLAIARDIGFPVIVKAAGGGGGRGMRVVQ
EASALLDALALTREEARRAFGNPEVYIEKFLTHPRHVEIQVLADRYGHALWLGSRDCSLQ
RRHQKILEEAPAPGIEPSLIAAVGERCAAACRRIGYCGVGTFEFLYENGAFYFIEMNTRL
QVEHPVTEMTSGIDIVQQQIRVARGEPLTLRQDDIICQGHALECRINAEHPDTFAPSPGV
ITGWQLPGGYGVRVDTHAGAGYRVPSHYDSMIAKLIVHGASREDALRRMCLALDELQVDG
IATNLPLHREVVRDKDFEAGGVDIHHLERWLRARTERRNETR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacaggggtttcgtcatgttcgacacagtgctgattgccaatcgcggagagatc
gccttgcgtatccagcgcgcttgccgtgggctcggcttgcgcaccgtggccgtctattcg
gaggccgatcgtgacgccgtctacgtgcgtcaggccgaccaggcgctctgcatcggtccg
gcgtcgcccaccgccagttacctgaaccaggcagcgctgctcgcggcggcgcgcgtcagc
ggcgcacaggccattcaccctggctatgggttcctgtcggaaaacgcaggcttcgtggag
cgcgtgaccgacgccgggctcacgttcatcggccctagcgccgcttgcatccgcacgatg
ggtgacaaggtcagtgccaagcgggccatgcgcgaagccggtgtgccgtgcgtgccgggg
cccgacacgtccctgcccgaggatccggcagcggtgctggcgatcgcgcgcgatatcggt
tttccggtcatcgtcaaagcggcgggcggtggcggcgggcgcggcatgcgcgtggtgcaa
gaggcgtcggcgctgctggacgcgctggcgctgacgcgcgaagaggcgcgccgcgcgttc
ggcaatccagaggtttatatcgagaagttcctgacgcacccgcgccacgtggaaatccag
gtcctggccgaccgctacggccatgcgctgtggctgggcagccgggactgctcgctgcag
cgccggcaccaaaagatcctcgaggaggcaccggcgccgggcatcgagccgtcgctgatc
gccgcggtcggggagcgctgcgccgcggcatgccggcgaatcggctattgcggcgtgggc
accttcgagtttctctacgagaacggggcgttctacttcatcgagatgaacacccggctg
caggtcgagcacccggtgaccgagatgacctcaggtatcgacatcgttcagcagcagatt
cgcgtggcacgcggcgagccgctcacgctacggcaggacgacatcatctgccaaggccat
gcgctggagtgccgcatcaatgccgagcacccggacacgttcgcgccgtcgcccggggtg
atcaccggctggcagttgccgggcggctatggcgtgcgcgtggatacccatgccggcgcc
ggctatcgcgtgccatcgcactacgactcgatgattgcgaagctcatcgtgcatggcgcg
agccgcgaggatgcgttgcggcgcatgtgcctggcgctggacgaactgcaggtggacgga
atcgccaccaacctgccgctgcatcgcgaggtcgtccgggacaaggactttgaggcgggt
ggggtcgatatccaccacctggaacgctggctgcgcgcacgcaccgagcggcgtaacgag
acacgttga

KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0641Help
Entry
RPSI07_mp0641     CDS       T01273                                 

Definition
(GenBank) conserved hypothethical protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00061  Fatty acid biosynthesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
Module
rsl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_mp0641
   00640 Propanoate metabolism
    RPSI07_mp0641
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPSI07_mp0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: CBJ34985
LinkDB All DBs
Position
mpPSI07:789757..790164
Genome map
AA seq 135 aa AA seqDB search
METEHIRQICTWLAATDITEFDLQGPGVHLLLRNEGAAAPRVSAQPAPAASAAAVSPEVV
RAGSVGVFWHQHPQQTAPLAAVGATVRASQPLGLLQIGPLLLPVTAPCEAVVLDILVPDG
TVVGWGTSLVVLGTR
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgaacacattcgccagatctgcacttggctggcggcaaccgatatcacggaa
ttcgacctgcaagggccgggtgtccatcttttgttgcgcaacgaaggtgccgcggcgccg
cgggtcagcgcacagcccgcgcctgcggcatccgccgctgccgtatcgcccgaagtcgtg
cgcgctggttccgttggcgtgttctggcaccagcaccctcagcagacggctccgcttgcc
gccgtgggggcgaccgtgcgggcgtcccagccgttgggcctgttgcagattggcccgctg
ctgttgccggtgacggcgccgtgcgaggccgtggtgctggacatactggtgcccgacggc
acggtcgtgggctggggcacttcgctcgtcgtgctcggtacacgttga

DBGET integrated database retrieval system