KEGG   Ralstonia solanacearum PSI07: RPSI07_0742Help
Entry
RPSI07_0742       CDS       T01273                                 

Gene name
maeB
Definition
(GenBank) NAD(P)-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_0742 (maeB)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     RPSI07_0742 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: CBJ50104
LinkDB All DBs
Position
742519..744864
Genome map
AA seq 781 aa AA seqDB search
MTTVDTQPQQPARTDEELKAQQRAALRKAALEYHEFPTPGKISVTPTKPLSNQRDLALAY
SPGVAAACEEIVADVSNSFRYTARGNLVAVVTNGTAVLGLGDIGPEAAKPVMEGKGGLFK
KFAGIDVFDIEINEKDPQKLVDIIASLEPTFGGINLEDIKAPECFFVERELRKRMKIPVF
HDDQHGTAIVVGAGITNALKVVGKDIKKVKLVASGAGAAALACLDLLVDLGLPRENIWVT
DLAGVVYEGRTELMDPDKAVFAQKTDKRTLAEVIDGADIFLGLSAAGVLKQDMVKRMADR
PVIFALANPNPEIMPELAKEVRPDVIMGTGRTDYPNQVNNVLCFPFIFRGALDVGATTIT
REMEVAAVNAVAELARQEQSDIVATAYGIQDLSFGPEYLIPKPFDPRLIVKIAPAVAQAA
MDSGVAQRPIEDMDAYRQHLQQFVYHSGTLMKPIFSAARKVPMEHKRIVFAEGEEERVLR
AVQVVVDEKLANPILIGRPGVIAHRIERFGLRLREGVDFTIVNPEHDERFREYWETYYKL
MARKGVTPQYAKLEVRRRSTLIGAVMIHKGEADGMICGTVSTTAAHLRYIDQVIGGTNCV
YAAMNGLVLPGRQIFLTDTHVNIDPTAEQLAEITIMAAEELCRFGIKPKVALVSHSNFGS
SEAPSAVKMRETLAILRERAPQLEVDGEMHGDAALDQKLRDALVPDSTLDGEANLLVMPN
IDAANIAYNLLKTTAGNNIAIGPILLGAKRPVHILTPSATVRRILNMTALTVVDAAAQAQ
R
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggtggatacccagcctcaacagcccgcccgcacggacgaagaactcaaggcg
caacaacgcgccgccttgcgcaaggccgcgctggagtaccacgagttcccgaccccgggc
aagatttcggtcacgccgaccaagccgctgtccaaccagcgcgacctggccctggcgtac
tcccccggcgtcgccgccgcctgcgaggagatcgttgccgacgtttccaactccttccgc
tataccgcccgcggcaacctggtcgccgtggtgaccaacggcaccgccgtgctgggcctg
ggcgatatcggccccgaagcggccaagccggtgatggaaggcaagggcggccttttcaag
aaattcgccgggatcgatgtctttgacatcgagatcaacgaaaaagacccccagaagctg
gtcgatatcatcgcctccctggagccgaccttcggcggcatcaacctggaagacatcaag
gcgccggagtgcttcttcgtcgagcgcgaactgcgcaagcgcatgaagatccccgtcttc
cacgatgaccagcacggcaccgccatcgtggtgggcgcgggcatcaccaacgcgctcaag
gtggtcggcaaggacatcaagaaggtcaagctggtggcctcgggcgccggcgcggccgca
ctggcttgcctggacctgctggtcgacctgggcctgccgcgcgagaacatctgggtgacg
gacctggcgggcgtggtctacgagggccgtaccgagctgatggacccggacaaggccgtc
ttcgcgcagaagaccgacaagcgcacgctggccgaagtgatcgacggcgccgatattttc
ctgggcctgtccgccgccggcgtgctcaagcaggacatggtcaagcgcatggccgaccgg
ccggtcatcttcgcgctggccaacccgaatcccgagatcatgccggagctggccaaggag
gtgcgcccggatgtcatcatgggcacgggccgcaccgattatccgaaccaggtcaacaac
gtcctgtgcttcccgttcatcttccgcggcgcgctggacgtgggcgcgaccaccatcacg
cgcgagatggaagtcgccgccgtgaatgccgtggccgagctggcccgccaggagcagagc
gacatcgttgccacggcgtatggcatccaggacctgtcgttcggaccggaatacctgatc
ccgaagcccttcgatccgcgcctgatcgtgaagatcgcgccggcggtggcgcaggctgcc
atggactccggcgtggcgcagcgcccgatcgaggacatggacgcctaccgccagcacctg
cagcagttcgtctaccactcgggcacgctgatgaagccgatcttctcggctgcacgcaag
gtgccgatggagcacaagcgcatcgtcttcgccgagggcgaagaggagcgcgtgctgcgt
gccgtgcaggtcgtcgtcgatgaaaagctggccaacccgatcctgatcggccgcccgggc
gtgatcgcccaccgcatcgagcgcttcggcctgcgcctgcgcgagggcgtcgacttcacc
atcgtcaacccagagcacgacgagcgtttccgcgaatactgggagacgtactacaagctg
atggcgcgcaagggcgtcacgccgcagtacgccaagctggaagtgcgccgccggtccacg
ctgatcggcgccgtgatgatccacaagggcgaggccgacggcatgatctgcggtacggtc
agcaccaccgccgcccatctgcgctatatcgaccaggtcatcggcggcaccaactgcgtg
tacgcggcgatgaacggtctggtgctgccgggccgccagatcttcctgaccgacacgcac
gtcaacatcgacccgactgccgagcagctggccgagatcaccatcatggctgctgaagag
ctgtgccgtttcggcatcaagccgaaggtggcgctggtctcgcattcgaatttcggctcg
tccgaggcgccttctgccgtcaagatgcgcgaaaccctcgccatcctgcgcgaacgcgcc
ccgcagctggaagtggacggcgaaatgcacggcgatgccgcgctcgaccagaagctgcgc
gatgcgctggtgccggattccacgctggacggcgaagccaacctgctggtgatgccgaac
atcgacgccgccaacattgcctacaacctgctgaagacgacggccggcaacaacatcgcc
atcggcccgatcctgttgggggccaagcgtccggtgcatatcctgacgccgtcggccact
gtgcggcgcattctcaacatgacggcattgaccgttgtggacgccgcagcacaggcgcaa
cgctga

DBGET integrated database retrieval system