KEGG   Ralstonia solanacearum PSI07: RPSI07_0976Help
Entry
RPSI07_0976       CDS       T01273                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00020  Citrate cycle (TCA cycle)
rsl00480  Glutathione metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01210  2-Oxocarboxylic acid metabolism
rsl01230  Biosynthesis of amino acids
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_0976 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPSI07_0976 (icd)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RPSI07_0976 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CBJ50336
UniProt: D8NZI3
LinkDB All DBs
Position
981281..982531
Genome map
AA seq 416 aa AA seqDB search
MYQHIKVPAGEKITVNQDFSLNVPDNPIIPYIEGDGTGFDITPVMIKVVDAAVAKAYAGK
RKISWMEIYAGEKSTKVYGPDVWLPEETLQVLKDYVVSIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEWAAESEQAKKVIAFLR
NEMGVKKIRFPETSGIGIKPVSKEGTQRLVRKAIQYAIDNDKPSVTIVHKGNIMKFTEGG
FRDWAYELAQKEFGAELIDGGPWCKFKNPKTGKDIIVKDAIADAFLQQILLRPAEYSVVA
TLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILSA
EMMLRHMGWTEAADLIISSIEKSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaacacatcaaggtcccggccggagagaagatcaccgtcaaccaagacttctcc
ctgaacgtccccgataaccccatcattccttacatcgagggcgacggcaccggcttcgac
atcaccccggtgatgatcaaggtggtggacgcggccgtggccaaggcctacgccggcaag
cgcaagatttcctggatggaaatctacgccggcgagaagtcgaccaaggtgtacggcccg
gacgtgtggctgccggaagaaaccctgcaggtcctcaaggactacgtggtctcgatcaag
ggtccgctgacgacgccggtgggcggcggcatccgttcgctgaacgtggcgctgcgccag
gagctggacctgtacgtctgcctgcgcccggtgcgctacttcaagggcgtgccttcgccg
gtgcgcgagcccgagaagaccgacatggtcatcttccgcgagaactcggaagacatctac
gccggcatcgagtgggccgccgagagcgagcaggccaagaaggtcatcgccttcctgcgc
aacgagatgggcgtgaagaagatccgcttcccggaaacctcgggcatcggcatcaagccg
gtttccaaggaaggcacgcagcgcctggtgcgcaaggctatccagtacgcgatcgacaac
gacaagccgtcggtcacgatcgtgcacaagggcaacatcatgaagttcacggaaggcggc
ttccgtgactgggcctacgagctggcccagaaggaattcggcgccgagctgatcgacggc
ggtccgtggtgcaagttcaagaatccgaagacgggcaaggacatcatcgtcaaggacgcg
attgccgacgccttcctgcagcagatcctgctgcgtccggccgagtactcggtggtggcg
acgctgaacctgaacggcgactacatctccgacgccctggctgcacaagtcggcggtatc
ggtatcgctccgggtgccaacctgtcggattcggtggccatgttcgaagccacccacggc
acggcgccgaagtacgctggcaaggactacgtgaacccgggttcggaaatcctgtcggcc
gaaatgatgctgcgccacatgggctggacggaagccgctgacctgatcatctcgtcgatc
gagaagtcgatcctgtcgaagaaggtcacgtatgacttcgcccgcctgctggaaggcgcg
acgcaggtgtcgtgctcgggctttggtcaggtgatgattgacaatatgtaa

DBGET integrated database retrieval system