KEGG   Ralstonia solanacearum PSI07: RPSI07_1074Help
Entry
RPSI07_1074       CDS       T01273                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00860  Porphyrin and chlorophyll metabolism
rsl01100  Metabolic pathways
Module
rsl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPSI07_1074
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     RPSI07_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ50433
LinkDB All DBs
Position
1078990..1079568
Genome map
AA seq 192 aa AA seqDB search
MDIILIRHARPAMAAGLCYGRTDLPLDEPMDPDAASIADKLAAHPPQRLLASPLQRSVLT
ARALAQATGLPMPELDARLVELDFGAWEGCQWDDIPRAELDRWAHDVLHGSPHGGESAAD
LMVRVTDWAAAMAIAPVPCIWAVTHAGCMRALAAHWLQRPVTETMQWPLQWGSACGFRVL
PDGPPLLLFWNR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggacatcatcctgatccgccacgcgcgtccggccatggccgcgggcctgtgctacggc
cgcaccgatctgccgctggacgagccgatggatcccgacgccgccagcatcgccgacaag
ctcgccgcgcatccgccgcagcggctgctggccagcccgctgcagcgcagtgtgctgacg
gcccgggcactggcgcaggcgacgggcctgccgatgcccgaactggatgcccgcctggtg
gaactggacttcggtgcctgggaaggctgccagtgggacgacatcccacgcgccgagctg
gaccgctgggcccacgatgtgctgcacggcagcccgcacggcggcgaatcggccgcggac
ctgatggtgcgggtgacggattgggcggctgcgatggcaatcgcgccggtgccctgcatc
tgggccgtgacgcacgccggctgcatgcgagcgctcgccgcgcactggctgcagcgcccg
gtgaccgaaaccatgcaatggccgctgcaatggggcagcgcctgcggattccgcgtgctg
cccgacgggccgccgctgctgctgttctggaaccgttga

DBGET integrated database retrieval system