KEGG   Ralstonia solanacearum PSI07: RPSI07_1100Help
Entry
RPSI07_1100       CDS       T01273                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RPSI07_1100 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBJ50459
UniProt: D8P087
LinkDB All DBs
Position
1108461..1109009
Genome map
AA seq 182 aa AA seqDB search
MKQLVIGLAAIGLMAGCASNAGTGASTSAPAAGTSALATLAPKSGSNVQGTIKLLQQGDN
RVAMAVDIAGLPPNGMFGFHVHEKGDCSSPDGMSAGGHFNPTGQPHGDPRSGPHHAGDIP
MLQSDANGKAVGSIVLNGVTLTPGPTSLVGHAVIVHSGMDDYKTQPTGNSGGRIACGVVV
AN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgtgatcggacttgccgcgatcggcctgatggccggctgcgcctcgaat
gccggcaccggcgccagcaccagcgcgcccgccgccggcacctcggctttggccacgctg
gcgcccaagagcggcagcaacgtgcaaggcaccatcaagctgctgcagcaaggcgacaac
cgggttgcgatggcggtcgacattgccggcctgccgcccaacggcatgttcggcttccat
gtgcacgagaagggcgactgctcctcgccggacggcatgagcgcgggcgggcacttcaac
ccgaccggccagccgcacggtgatccgcgttccggcccgcaccatgccggcgacatcccg
atgctgcagtccgatgccaatggcaaggccgtcggctcgatcgtcctgaacggcgtcacg
ctcacgcccggcccgaccagcctggtcggccacgcggtgatcgtccattcgggcatggat
gactacaagacccagccgaccggcaactccggcgggcgcatcgcctgcggcgtggtcgtg
gcgaactga

DBGET integrated database retrieval system