KEGG   Ralstonia solanacearum PSI07: RPSI07_1122Help
Entry
RPSI07_1122       CDS       T01273                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00053  Ascorbate and aldarate metabolism
rsl00071  Fatty acid degradation
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00330  Arginine and proline metabolism
rsl00340  Histidine metabolism
rsl00380  Tryptophan metabolism
rsl00410  beta-Alanine metabolism
rsl00561  Glycerolipid metabolism
rsl00620  Pyruvate metabolism
rsl00625  Chloroalkane and chloroalkene degradation
rsl00903  Limonene and pinene degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_1122
   00053 Ascorbate and aldarate metabolism
    RPSI07_1122
   00620 Pyruvate metabolism
    RPSI07_1122
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_1122
   00561 Glycerolipid metabolism
    RPSI07_1122
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_1122
   00310 Lysine degradation
    RPSI07_1122
   00330 Arginine and proline metabolism
    RPSI07_1122
   00340 Histidine metabolism
    RPSI07_1122
   00380 Tryptophan metabolism
    RPSI07_1122
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPSI07_1122
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPSI07_1122
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPSI07_1122
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RPSI07_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LPD7
Motif
Other DBs
NCBI-ProteinID: CBJ50481
LinkDB All DBs
Position
complement(1134904..1136340)
Genome map
AA seq 478 aa AA seqDB search
MHAQHFIANRLMAPDSGLRIKVFDPSDGQPFAEIARGNATDINVAVHAARRAFDGAWGRL
APAERGRLLMRVALRLADHEEELARLEARDTGKPMRQARADARAIARYFEFYAGAADKLH
GQTIPYRPDTTVLTVREPHGVTAHIIPWNYPMQIFGRSVGAALAAGNACVVKPAEDACLS
ILRVAELAAEAGLPDGALNVVTGYGHEAGAALAAHPGINHVSFTGSPETGKLIVRAAAEN
HVPVTLELGGKSPQILFADADLDAAIPAVVSGIVQNAGQTCSAGSRVLIERGLYETVLDR
LASVFESTKVGPSMLDLDCGPLINPRQQQRVWDFVSDAQHANIPVMAQGLVVPEAPETGY
YQAPMLLRDVPPAHRLAQEEVFGPLLAAMPFDSETEALALANGTPYGLVAGVWTRDGARQ
LRLARALKAGQVFINNYGAGGGVELPFGGTGQSGHGREKGFEALYGFTTVKTIAIRHG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccagcacttcatcgccaaccgcctgatggctccggactccggcctgcgcatc
aaggtgttcgacccgtccgacggccagccctttgcggagatcgcgcgcggcaacgccacc
gacatcaacgtggccgtgcacgccgcacgccgcgccttcgacggggcatggggcaggctg
gcaccggccgagcgcggccgcctgctgatgcgcgtggcgctgcgcctggccgaccatgaa
gaggaactcgcccggctggaagcgcgcgacacgggcaagccgatgcgccaggcccgcgcg
gacgcccgtgccatcgcccgctatttcgagttctatgccggcgccgccgacaagctgcac
ggccagaccatcccgtaccggcccgacaccaccgtgctgaccgtgcgcgaaccgcacggc
gtgacggcgcacatcatcccgtggaactacccgatgcagatcttcgggcgcagcgtgggc
gccgccctggcggcaggcaatgcctgcgtggtcaagccggcggaagacgcatgcctgtcc
atcctgcgtgtggccgaactggcggccgaggcgggcctgccggacggcgcgctgaacgtc
gtcaccggctacgggcacgaggccggcgcggcgctggcggcgcatcccggcatcaaccac
gtgtcgttcacgggatcgccggaaaccggcaagctgatcgtgcgcgcggcggcggaaaac
catgtgcccgtgacgctggagctcggcgggaaatcgccgcagatcctgttcgccgatgcc
gatctggatgcggcgattccggcggtggtgagcggcatcgtccagaacgcggggcagacc
tgctcggcgggcagccgcgtgctgatcgagcgcggcctgtacgagaccgtgctcgaccgc
ttggcaagcgtgttcgaatccaccaaggtgggcccgtcgatgctggacctggactgcggt
ccgctgatcaaccccaggcagcagcagcgcgtgtgggacttcgtgtcggacgcgcagcac
gccaacatcccggtgatggcgcaggggctggtggtgcccgaggcacccgaaaccggctac
taccaggcaccgatgctgctgcgcgacgtgccgcccgcccaccgcctggcacaggaagag
gtgttcggcccgctgctggccgccatgccgttcgacagcgagaccgaagcgctggcgctg
gccaacggcacgccgtacggactggtggcgggggtctggacgcgcgacggcgcacgccag
ttgcggctggcccgcgcgctgaaggcaggccaggtcttcatcaacaactacggcgcgggc
ggcggcgtggaactgcccttcggcggcacaggtcagtcgggccatggtcgcgagaaaggc
tttgaggcactgtacggcttcaccaccgtgaagaccatcgccatccgccacggctga

KEGG   Ralstonia solanacearum PSI07: RPSI07_3212Help
Entry
RPSI07_3212       CDS       T01273                                 

Definition
(GenBank) putative NAD(+)-dependent aldehyde dehydrogenase; exported protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00053  Ascorbate and aldarate metabolism
rsl00071  Fatty acid degradation
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00330  Arginine and proline metabolism
rsl00340  Histidine metabolism
rsl00380  Tryptophan metabolism
rsl00410  beta-Alanine metabolism
rsl00561  Glycerolipid metabolism
rsl00620  Pyruvate metabolism
rsl00625  Chloroalkane and chloroalkene degradation
rsl00903  Limonene and pinene degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_3212
   00053 Ascorbate and aldarate metabolism
    RPSI07_3212
   00620 Pyruvate metabolism
    RPSI07_3212
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_3212
   00561 Glycerolipid metabolism
    RPSI07_3212
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_3212
   00310 Lysine degradation
    RPSI07_3212
   00330 Arginine and proline metabolism
    RPSI07_3212
   00340 Histidine metabolism
    RPSI07_3212
   00380 Tryptophan metabolism
    RPSI07_3212
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPSI07_3212
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPSI07_3212
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPSI07_3212
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RPSI07_3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBJ52564
LinkDB All DBs
Position
3342903..3344414
Genome map
AA seq 503 aa AA seqDB search
MSLSPETLLQRLHLDTLIGGDGPLAARSPIDGAVLARLPVETAADADRIVAQAHTAFQQW
RTVPAPRRGELVRLLGEELRAHKADLGALVTLEAGKITQEGLGEVQEMIDICDFAVGLSR
QLYGLTIASERPSHRMMETWHPLGPCLVITAFNFPVAVWAWNAALALVCGDPVIWKPSEK
TPLTALAVERLFLRACQRFGEAPPHLAQVAIGERDLGEALARHPGIPLVSATGSTGMGRA
VAQAAAPRFARTILELGGNNAAIVCASADLALAERAIAFAAMGTAGQRCTSLRRLFVQRP
VYDALVPRLTTLYERVRVDDPREDGTLVGPLIDSHAYARMQAALARARAEGGTVHGGERI
AVGAGDHAYYVRPALVEMPAQGGVVREETFAPILYVVPFDSLDEAIALNNAVPHGLSSSL
FTLDMREAERFVSATGSDCGIANVNIGPSGAEIGGAFGGEKDTGGGREAGSDAWKAYMRR
ATNTVNYGTALPLAQGIRFDVGG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcgccagaaaccctgctgcagcgcctgcatctcgacaccctgatcggcggc
gacgggccgctcgcggcacgctcgcccatcgacggcgcggtgctcgcccgcctgccggtc
gaaacggccgccgacgccgaccgcatcgttgcgcaggcacataccgcgttccagcagtgg
cgcaccgtgcccgcgccgcgccgtggcgaactggtccggctgttgggtgaggaactgcgc
gcgcacaaggcggacctcggtgcgctggtcacgctggaagccggcaagatcacgcaggag
ggcctgggcgaagtgcaggagatgatcgacatctgcgacttcgccgtcggcctgtcgcgg
cagctgtatgggctcaccatcgccagcgagcggccctcgcatcgcatgatggaaacgtgg
catccgctgggcccgtgcctggtcatcaccgcgttcaacttcccggtggccgtgtgggcg
tggaacgcggcactggcgctggtatgcggcgacccggtcatctggaagccctcggagaag
acaccgctgacggcgctggcggtcgagcgcctgttcctgcgcgcctgccagcgcttcggc
gaggcgccgccgcacctggcgcaggtggccatcggcgagcgcgacctgggcgaggcgctg
gcgcgccacccgggcattccgctggtgtcggccaccggcagcactgggatgggccgcgcg
gtcgcccaggccgcggcgccccgctttgcgcgcaccatcctcgaactgggcggcaacaac
gccgccatcgtctgcgccagcgcggacctggcgctggccgaacgcgccatcgccttcgcg
gcgatgggcacggccgggcagcgctgcacatcgctgcgtcgcctgtttgtgcagcggccg
gtctacgacgcgctggtgccgcggctgaccacgctgtatgaacgcgtgcgggtggacgat
ccgcgcgaagacggcaccctggtcggcccgctgatcgacagccatgcctacgcgcggatg
caggccgcgctggcccgcgctcgcgccgaaggcggcacggtgcacggcggcgagcgcatc
gcagtcggcgccggcgatcacgcctactacgtccgccccgccctggtggagatgcccgcg
cagggcggcgtggtccgcgaggaaaccttcgcgcccatcctctacgtggtgccgttcgac
tcgctggacgaagcgatcgccttgaacaacgccgtaccgcacggactgtcgtcgagcctg
ttcacgctggacatgcgcgaggcggagcgcttcgtctcggccaccggcagcgactgcggc
atcgccaacgtcaacatcggcccgagcggcgcggagatcggcggtgcgttcggcggcgag
aaggacaccggcggcggccgcgaagccggctcggatgcgtggaaggcctacatgcgccgc
gctaccaataccgtcaactacggcactgcgctgccgctggcgcaggggatccggttcgat
gtcggcggctag

KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1039Help
Entry
RPSI07_mp1039     CDS       T01273                                 

Gene name
betB
Definition
(GenBank) Betaine aldehyde dehydrogenase (BADH)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00053  Ascorbate and aldarate metabolism
rsl00071  Fatty acid degradation
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00330  Arginine and proline metabolism
rsl00340  Histidine metabolism
rsl00380  Tryptophan metabolism
rsl00410  beta-Alanine metabolism
rsl00561  Glycerolipid metabolism
rsl00620  Pyruvate metabolism
rsl00625  Chloroalkane and chloroalkene degradation
rsl00903  Limonene and pinene degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_mp1039 (betB)
   00053 Ascorbate and aldarate metabolism
    RPSI07_mp1039 (betB)
   00620 Pyruvate metabolism
    RPSI07_mp1039 (betB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_mp1039 (betB)
   00561 Glycerolipid metabolism
    RPSI07_mp1039 (betB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_mp1039 (betB)
   00310 Lysine degradation
    RPSI07_mp1039 (betB)
   00330 Arginine and proline metabolism
    RPSI07_mp1039 (betB)
   00340 Histidine metabolism
    RPSI07_mp1039 (betB)
   00380 Tryptophan metabolism
    RPSI07_mp1039 (betB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPSI07_mp1039 (betB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPSI07_mp1039 (betB)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPSI07_mp1039 (betB)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RPSI07_mp1039 (betB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBJ35372
LinkDB All DBs
Position
mpPSI07:complement(1257200..1258675)
Genome map
AA seq 491 aa AA seqDB search
MFDPQTIRVPSGHFIGGQLVPDAGRIAVRRPSDNAVHAELPLGDAAAVDAAVLNAWQAWR
TSDWARRAPRERARVLRRWADLIEADAARLAPLEAVCSTRPVRDAGAWDVPFTAEGLRFF
AEYADKLGGDVAATRHDHLGMVVAEPYGVVGAITPWNFPLVMVSWKVGAALAAGNAVVLK
PSEMTPFSAVRLAELAIDAGVPAGLFNVVQGDGRTTGDALTRHPLISKMTFTGSTRTGAA
IMASCAAHGPKPVTLELGGKSPQLVFDDAPDIDRLAGMIAGAITGNAGQVCVAGSRLIVQ
RGIAPALVERIAARFAALRPGATWDDAATLPPIISAAQAARILDIVERARDAGAALRCGG
GLFGEGPGGAYFQPTLIEGVSADNPAVREEIFGPVLTVQTFEDEAQGLALAAHEHYGLAA
GVHTADIGRALRAMRGIAAGTVWINRYGRSADFVIPTGGYHQSGIGKDLGRQAVEANLRF
KSVLIDFAAAH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaccctcagaccatccgcgtgccctcggggcatttcattggcgggcagctcgtg
cccgatgccggccgcatcgccgtgcggcgcccttccgacaacgcggtgcatgccgagttg
ccgctgggcgacgccgccgcggtggatgccgccgtgctgaacgcgtggcaggcctggcgc
acgagcgactgggcgcgccgtgccccgcgcgagcgggcccgtgtactgcgccgctgggcc
gacctgatcgaggccgatgccgcgcgcctggcgccgctcgaagccgtgtgctcgacgcgc
ccggtgcgcgatgctggagcttgggatgtgccgttcaccgccgaggggctgcgcttcttt
gccgaatatgccgacaagctcggcggcgacgtggccgccacgcggcacgaccatctgggc
atggtggtggccgagccgtacggcgtggtgggggcgatcacgccgtggaattttccgctg
gtgatggtgtcgtggaaggtgggggcggcgcttgccgccggcaacgcggtggtgctcaag
ccttccgagatgacgccgttctcggccgtgcgcctggccgaactggccattgacgccggt
gtgccggcaggtctgttcaacgtggtgcagggcgacggccgcaccacgggcgatgcgctc
acgcgccatccgttgatctcgaagatgaccttcacggggtcgacgcgcacgggcgcggcc
atcatggccagctgcgcggcccatggccccaagccggtcacgctggagctgggcggcaag
agcccgcaactggtcttcgatgacgcgccggacatcgaccggctggccggcatgattgcc
ggggccatcaccggcaacgcggggcaggtgtgcgtcgcgggctcgcgcctgatcgtgcag
cgcggtatcgcgccggcgctggtcgagcgcatcgcggcgcgctttgccgcgctgcggccc
ggcgccacctgggatgacgcggccacgctgccgcccatcatctcggcggcacaggcggca
cgcatcctcgacatcgtggagcgtgcgcgcgacgccggcgcggcgttgcgttgcggcggc
ggcctgttcggcgagggcccgggcggggcgtacttccagcccacgctgatcgaaggcgtg
agcgcggacaatcccgccgtgcgggaggaaatcttcggccccgtgctgacggtgcagacc
ttcgaggacgaagcgcaaggcctggcgctggccgcgcacgagcactacggcctggcggcc
ggcgtgcacacggccgacatcggacgggcgctgcgtgccatgcgcggcatcgccgccggc
acggtgtggatcaaccgctacgggcgcagcgcggactttgtgattcccaccggcggctat
caccagtccggcatcggcaaggacctgggtcggcaggccgtggaggcgaacctgcgcttc
aaaagtgtgctcatcgattttgctgcggcgcattag

KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1691Help
Entry
RPSI07_mp1691     CDS       T01273                                 

Definition
(GenBank) probable Aldehyde dehydrogenase family 7 member A1, similar to eukaryote aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00053  Ascorbate and aldarate metabolism
rsl00071  Fatty acid degradation
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00330  Arginine and proline metabolism
rsl00340  Histidine metabolism
rsl00380  Tryptophan metabolism
rsl00410  beta-Alanine metabolism
rsl00561  Glycerolipid metabolism
rsl00620  Pyruvate metabolism
rsl00625  Chloroalkane and chloroalkene degradation
rsl00903  Limonene and pinene degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_mp1691
   00053 Ascorbate and aldarate metabolism
    RPSI07_mp1691
   00620 Pyruvate metabolism
    RPSI07_mp1691
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_mp1691
   00561 Glycerolipid metabolism
    RPSI07_mp1691
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_mp1691
   00310 Lysine degradation
    RPSI07_mp1691
   00330 Arginine and proline metabolism
    RPSI07_mp1691
   00340 Histidine metabolism
    RPSI07_mp1691
   00380 Tryptophan metabolism
    RPSI07_mp1691
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPSI07_mp1691
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPSI07_mp1691
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPSI07_mp1691
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RPSI07_mp1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBJ36010
LinkDB All DBs
Position
mpPSI07:complement(1969269..1970783)
Genome map
AA seq 504 aa AA seqDB search
MRVSEILSSLYIEGSANIEGGHKVRSPIDGAVIGSVKLASAKEGEAAIDRAHAAFLQWRG
VPAPVRGELVRLLGVELRRHKAALGRLVTLEAGKILSEGLGEVQEMIDICDFAVGLSRQL
YGLTIASERPGHRMMETWHPVGVVGVISAFNFPAAVWAWNSALAFVCGDSVVWKPSEKTP
LTALACDALFKKAVAEFGKAHPGTAPDGLHELLVGGRDAGEALVHAKQVPVVSATGSTRM
GRFVSARVGERFGRAILELGGNNAMIVAPSADLELATRAITFAAVGTAGQRCTTLRRLIV
HESVAATLVERLKRIYGSVTVGDPLQEGTLIGPLIDAGAYAAMVHALERAGAQGGTIHGG
DRTRLEAGQDAYYVTPALVEMPAQTEVMQEETFAPILYVLTYRTLEDAIALQNGVPQGLS
SAIFTRDLNEAEWFLSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAY
MRRATNTINYSNKLPLAQGVRFDV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtttccgaaattctgtcgtccctgtacatcgagggttccgccaacatcgagggt
ggccacaaggtgcgctcccccatcgatggcgccgtcatcggtagcgtgaagctggcctcg
gccaaggagggcgaggcggccatcgatcgtgcccacgcggcgttcctgcaatggcgcggg
gtgcccgctcccgtgcgcggcgagctggtgcgcctgctgggtgtcgaactgcgcaggcac
aaggcggccctggggcggctggtgacgctggaagccgggaagatcctgtccgaagggctg
ggcgaagtccaggagatgatcgacatctgcgactttgcagtgggcctgtcgcgccaactg
tacgggctgacgatcgcgtccgagcgcccgggccatcggatgatggagacctggcatccg
gtcggcgtggtcggcgtgatctcggccttcaatttccctgccgccgtctgggcctggaac
agcgcgctcgccttcgtctgcggagacagcgtggtctggaagccgtccgagaagacgccg
ttgaccgcgctggcctgcgatgccttgttcaagaaagcggtcgcggaattcggcaaggcc
catccgggcaccgcgcccgacgggctccatgagctgctcgtcgggggccgcgatgcgggc
gaggcgctggtgcacgcgaagcaggtaccggtggtcagcgcgaccggcagcacccgcatg
ggccgtttcgtctcggcgagggtgggggagcggtttggccgcgccatcctggagctgggt
ggcaacaacgcgatgatcgttgcgccgagcgcggacctggaactggccacgcgcgcgatc
acctttgcggccgtgggcacggccgggcagcgatgcacgacgctgcgccgcctgatcgtc
catgaaagtgtggcagcgacgctcgtcgagcgcctgaagcgcatctatggatcggtgacg
gtgggtgacccgctccaggagggcacgctgatcggcccgctgatcgatgccggcgcgtac
gcggcgatggtgcatgcgcttgaacgggcgggcgcccagggcggcacgatccatggcggc
gatcgcacgcgcctggaggccggccaggatgcctactacgtgacgccggccctcgtcgag
atgcccgcccagaccgaggtgatgcaggaagagaccttcgcgcccatcctgtacgtcctg
acgtatcggacgctggaggacgccatcgcgctgcagaacggcgtgccccagggtttgtcg
tctgcgatcttcacgcgcgacctgaacgaggcggagtggttcctgtccgcggccggcagc
gattgcggcatcgccaacgtcaacatcggcacgtcgggtgcggagatcggcggcgcgttc
ggcggcgaaaaggagaccggcggcggccgggaatccggatcggacgcctggaaggcctac
atgcgccgcgcgaccaacaccatcaactacagcaacaagctgccgctggcgcaaggcgtg
cgtttcgatgtctga

DBGET integrated database retrieval system