KEGG   Ralstonia solanacearum PSI07: RPSI07_1310Help
Entry
RPSI07_1310       CDS       T01273                                 

Gene name
maeB
Definition
(GenBank) NAD(P)-dependent malic enzyme; bifunctional: Malate dehydrogenase (N-terminal); Phosphate acetyltransferase (C-terminal)
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_1310 (maeB)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     RPSI07_1310 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH ELFV_dehydrog Amidase_2
Motif
Other DBs
NCBI-ProteinID: CBJ50670
LinkDB All DBs
Position
1341507..1343834
Genome map
AA seq 775 aa AA seqDB search
MNDKLHDASPDTLDKGAEAELRRAALEYHRSPTRGKIEVRSTKTLINQRDLSLAYSPGVA
YACTEIERDPSLAAEYTSRANLVGVITNGTAVLGLGDIGPLAGKPVMEGKGCLFKKFAGV
DVFDIELAERDPDKLVDIIASLEPTLGGINLEDIKAPECFYIEQKLRERLNIPVFHDDQH
GTAIISSAALLNGLKVVGKQIGEVKVAVSGAGAAAIACLDLMVSLGVKRENVFVVDSKGV
IYVGRDAKMEPNKARYAQDTAARTLADIVRDADVFLGCSAAGVLTGDMVKTMAPNPIILA
LANPEPEIRPEVAKAARPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEAMKL
ACVKAIAELAEAETNDAVAQAYAGQELNFGPDYIIPKPFDSRLIEKIAPAVAKAAMESGV
ATRPIADLDAYRHQLNDFVYHTGLTMRPVFSAAKAAPKRVVYAEGEEERVLRAVQTVVDE
GLAKPILVGRPHVIEMRIQKAGLRLKPGVDFELVNPEDDPRYHQYHTAYHELMGRNGVTP
DMAKSALRRSNTLIGALLVRLGDADAMLCGTVGRFDAHLEHVRDVIGLAPNAKVFAAMNG
LMLEKHTLFITDTFVNEDPTAEELAAITELAAEEVRRFGLEPKVAMLSHSMFGSSKRTSA
HKMRAAYDLLKAQAPDLQVEGEIQGDAALSEDIRHHFLPKSAFAGSANLLVMPTLDAANI
AFNLLKITGGHGVTVGPILLGAAKPVHILNPAATSRRIVNMTALAVADVSAAARR
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaagcttcacgacgcctcgcccgatacgctcgacaagggggccgaggccgaa
ctgcgccgcgccgcactcgaataccaccgctcgccgacgcgcggcaagatcgaggtccgc
tcgaccaagacgctgatcaaccagcgtgacctgtcgctggcgtattcgccgggcgtggcc
tacgcgtgtaccgagatcgagcgcgatccgtcgctggcggccgagtacacctcgcgcgcc
aacctggtcggtgtgatcaccaacggcaccgcggtgctgggcctgggcgacatcggtccg
ctggccggcaagccggtgatggaaggcaagggctgcctgttcaagaagttcgccggcgtg
gatgtgttcgacatcgagctggccgagcgcgatccggacaagctggtcgacatcatcgcc
tcgctggagccgacgctgggcggcatcaacctcgaggacatcaaggcgccggagtgcttc
tacatcgagcagaagctgcgcgagcgcctgaacattcccgtcttccacgacgaccagcat
ggcacggcgatcatctcgtccgccgcgctgctcaacggcctgaaggtggtcggcaagcag
atcggcgaggtcaaggtggcggtgtcgggcgcgggcgcggcggccatcgcctgcctggac
ctgatggtgagcctgggcgtcaagcgcgagaacgtgttcgtggtcgactccaagggcgtc
atctatgtcggccgcgatgccaagatggagccgaacaaggcgcgctatgcgcaggacacc
gcggcccgcacgctggccgacatcgtgcgcgatgcggatgtgttcctgggctgctcggct
gccggcgtgctgacgggcgacatggtcaagaccatggcacccaacccgatcatcctggcg
ctggccaaccccgagccggaaatccgcccggaagtggccaaggccgcgcgcccggactgc
atcatcgccacgggccgttcggactatccgaaccaggtcaacaacgtgctgtgcttcccg
tacatcttccgcggcgcgctcgattgcggcgctaccaagatcacggaagcgatgaagctg
gcgtgcgtgaaggccattgctgagctggccgaagccgagaccaacgacgccgtggcccag
gcctatgccggccaggaactgaacttcggtccggactacatcattccgaagccgttcgat
tcgcgcctgatcgagaagatcgcgccggcggtggccaaggccgcgatggaatccggcgtg
gcgacgcgcccgatcgccgacctggacgcgtatcgccaccagctcaacgatttcgtctac
cacaccggcctgaccatgcgcccggtgttctccgccgccaaggccgcgcccaagcgcgtg
gtctacgccgagggcgaagaggagcgcgtgctgcgcgccgtgcagaccgtggtcgacgag
ggcctggccaagccgatcctggtcggccgcccgcacgtgatcgagatgcgcatccagaag
gccggcctgcgcctgaagccgggcgtggatttcgagctggtgaacccggaagacgatccg
cgctaccaccagtaccacaccgcctaccacgagctgatgggccgcaacggcgtgacgccc
gacatggcgaaatccgcgctgcgccgctccaacacgctgatcggcgcgctgctggtgcgc
ctgggcgatgccgatgcgatgctgtgcggcacggtgggccgtttcgacgcgcacctcgag
cacgtgcgcgacgtgatcggcctggcacccaacgccaaggtgttcgccgccatgaacggg
ctgatgctggagaagcacacgctgttcatcaccgacaccttcgtcaacgaggatccgacg
gccgaagagctggccgcgatcaccgagctggccgctgaggaagtgcgccgtttcggcctg
gagccgaaggtggcgatgctgtcgcactcgatgttcggttcgtccaagcgcacgtcggcg
cacaagatgcgcgcggcatacgacctgctcaaggcgcaggcgccggacctgcaggtggaa
ggcgagatccagggcgatgctgcgttgtccgaagatatccgccatcacttcctgcccaag
agcgcgtttgccggcagcgccaacctgctggtgatgccgacgctggatgccgccaacatc
gccttcaacctgctcaagatcacgggcgggcatggcgtgacggtgggcccgatcctgctg
ggcgcggccaagccggtgcacatcctcaacccggcggccacgtcgcggcggatcgtcaac
atgaccgcgctggcggtggcggacgtgtcggctgctgcgcggcgttga

DBGET integrated database retrieval system