KEGG   Ralstonia solanacearum PSI07: RPSI07_1320Help
Entry
RPSI07_1320       CDS       T01273                                 

Definition
(GenBank) conserved hypothethical protein
Organism
rsl  Ralstonia solanacearum PSI07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAT
Motif
Other DBs
NCBI-ProteinID: CBJ50680
LinkDB All DBs
Position
complement(1353502..1354560)
Genome map
AA seq 352 aa AA seqDB search
MPSLAFVDISGSPFEAGQALGRFGTAAVHQHLLRTEAWHSVMRWRGSPLADAMAALVRER
FPRIWAELQGLADGLQLPLEEVFLWNCRGDVWAATNDGCTTVQLPGADQRRIAHNEDGDP
GFAGHCALAQCHIDGSPGFAAFVYPGSLPGHTFAVTDAGLTMTVNNLRLREVATGVPRMV
LTRAVLDAADLDAAVWVLRESPRAGGFHLTLGHCAHPALLSVEFGAHGCSALEISEPSLH
ANHAIHPAMRDVPQVITDSSRHRQVRGDALLAESRAGGKAIDPLAILADQGDAALPIYRA
DPHDPDNENTLATANIAILPTHIEWAVYEHPGSPARYRMVNGHQQTEVAPQG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcacttgcttttgtagacatttccggctcgccgtttgaagcgggccaagcgctg
ggccgctttggcaccgccgccgttcaccagcacctgttgcgtaccgaagcctggcacagc
gtgatgcgctggcggggcagtcctctggctgatgccatggcggcgctcgtccgcgagcgt
tttccacgcatctgggccgaattgcagggcctggccgacggcctgcaactgccgctcgaa
gaggtgttcctatggaactgccgaggcgatgtctgggcggccaccaacgacggatgcacc
acggtgcagctccccggcgccgatcagcggcggatcgcccataacgaagacggcgacccc
ggtttcgccggacattgcgcgctcgcacagtgccacatcgacggcagcccgggcttcgct
gcgttcgtgtatccgggctcgctgccggggcacaccttcgccgtgaccgatgccggcctg
accatgacggtcaacaacctgcgcttgcgcgaggtggcgaccggcgtgccgcgtatggtc
ctgacgcgtgcggtgctggatgcggccgacctcgacgcggcggtatgggtcctgcgcgaa
tcgccccgcgcgggcggtttccatctcacgctcggccattgcgcacatcccgcgttgctg
agcgtcgagttcggtgcacacggctgctcggcgctggaaatatccgagccgtccttgcat
gcgaatcatgcgatccatccggcgatgcgcgatgtaccacaagtcatcaccgattcctcc
cgccaccggcaggtgcgcggcgatgccctgctggccgagtcgcgcgcaggcggaaaggcc
atcgacccgctcgcaatcctggccgaccagggggacgcggccctgccgatctatcgcgcc
gatccgcacgaccccgacaacgagaacacgctggccaccgccaacatcgccatcctcccg
actcacatagaatgggcggtttacgaacatcccgggagtccggcccggtatcggatggtc
aatggacaccagcaaacagaggtcgcgccgcaaggctga

DBGET integrated database retrieval system