KEGG   Ralstonia solanacearum PSI07: RPSI07_1379Help
Entry
RPSI07_1379       CDS       T01273                                 

Gene name
nuoM
Definition
(GenBank) NADH-quinone oxidoreductase subunit M
  KO
K00342  NADH-quinone oxidoreductase subunit M [EC:7.1.1.2]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00190  Oxidative phosphorylation
rsl01100  Metabolic pathways
Module
rsl_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPSI07_1379 (nuoM)
Enzymes [BR:rsl01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     RPSI07_1379 (nuoM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Motif
Other DBs
NCBI-ProteinID: CBJ50740
LinkDB All DBs
Position
1412936..1414402
Genome map
AA seq 488 aa AA seqDB search
MVLSFAIWLPIFFGVLVLASGSDRNPGYVRWMSLIGSLISFVITLPLITRFDKSTAAMQF
VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAQYMAAFLILSG
LMIGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAIKFFLYTLLGSLLTLVAFL
YLYFHSGTFEILQWHQVKLSLNEQILLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPTGGS
VVLAAIMLKLGAYGFLRFSLPIAPDASHSLAAFVIAISLIAVIYIGLVALVQADMKKLVA
YSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYGG
VVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVQFNFWIGLLAATALIFGAAYS
LWMVKRVIFGDVANKHVAELQDLNAREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNLL
THVAQTKL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtcttttgcgatctggctgccgatcttttttggcgtgctggtgctggcttcg
ggctcagaccgcaatcccggttatgtccgctggatgtcgctgatcggctcgctgatcagc
ttcgtgatcacgctgccgctgatcacgcgtttcgacaaatcgaccgcggcgatgcagttc
gtcgagaagtcgagctggatcgagcgcttccacatcagctactacctcggggtcgacggc
atctcgatgtggttcgtggtgctgacggcgttcatcaccgtgatcgtcgtgatctcggcg
tgggaggtgatcaccgagcgcgtcgcgcagtacatggcggcgttcctgattctctccggc
ctgatgatcggcgtgttcgcggcgctcgacggcctgctgttctacgtgttcttcgaagcc
acgctgatcccgatgtacatcatcatcggcgtgtggggcggcccgaaccgtgtgtatgcg
gccatcaagttcttcctgtacacgctgctgggttcgctgctgacgctggttgcgttcctg
tacctgtacttccacagcggcacgttcgagatcctgcagtggcaccaggtcaagctgtcg
ctgaacgagcagatcctgctgttcatcgccttcttcatggcgtttgccgtgaaggtgccg
atgtggccggtgcacacctggctgccggatgcccacgtggaagcgccgaccggcggttcg
gtggtgctggccgccatcatgctgaagctgggcgcgtacggtttcctgcggttctcgctg
ccgatcgcgccggatgccagccatagcctggcggccttcgtcatcgcgatttcgctgatc
gccgtgatctacatcggcctggtggcgctggtgcaggccgacatgaagaagctggtggcg
tattcctcgatcgcgcacatgggcttcgtcaccctgggcttcttcatcttcaacgagatc
ggcgtcgagggcggcatcgtgcagatgatctcgcacggctttatctcgggcgcgatgttc
ctgtgcatcggcgtgctgtacgaccgcgtgcactcgcgccagatcgccgactacggcggc
gtggtgaacacgatgccgaagttcgcggcgctgtcggtgttcttcgcgatggccaactgc
ggcctgccggcgacctccggtttcgtgggcgaattcatggtgatcctgggttcggtccag
ttcaacttctggatcggcctgctggcggccaccgcgctgatcttcggcgcagcgtactcg
ctgtggatggtcaagcgcgtgatcttcggcgacgtggcgaacaagcacgtggccgagctg
caagacctgaatgcgcgcgaattcttcatgctgggcgtactcgcgatcgcgaccctgtac
atgggcctgtatccgaagcctttcaccgatgtcatgcatgcgtccgtggtgaatctcctc
acccacgtggcccagaccaagctgtaa

DBGET integrated database retrieval system