KEGG   Ralstonia solanacearum PSI07: RPSI07_1385Help
Entry
RPSI07_1385       CDS       T01273                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
Organism
rsl  Ralstonia solanacearum PSI07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: CBJ50746
LinkDB All DBs
Position
1418802..1419932
Genome map
AA seq 376 aa AA seqDB search
MDFSFTDEQKQLADAVRRFVDKDYGFEARNKVVYSAGGVSQAHWDALAELGLTALPVPEA
QGGFDGRAMDLLVVMQELGRGLVVEPYAVTVLGTQALKLAGGQDALLEPVAGGALKLAVA
FGEPQSRYELFNVTTRAAQQGGGWTLSGAKAVVVHGGQADKLVVSARTGGEARDTSGLSL
FLVDREAAGVTVKDYRTIDNLRAADIRFDNAPATLLGKAGEAWEIIDAVADFGCVLLCAE
AIGLIDALNAATLEYTKTRQQFGVPIARFQALQHRMVDMFIHAEQARSITYLAAAHFEDG
DAEARRRYVSAAKARVGQAAREVGQEAVQLHGGMGVTNELPAAHMFKRLTMINTTLGDVD
HHLARFASLPGFRNAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatttctcgttcaccgacgaacagaagcagctggcggatgcggtgcgccgcttcgtc
gacaaggattacggtttcgaggcacgcaacaaggtcgtctattcggccgggggcgtgtcg
caggcgcactgggacgcgctggccgagctgggcctgaccgcgctgccggtgccggaggcg
cagggcggcttcgacggccgcgcgatggacttgctggtggtgatgcaggagctgggccgt
ggcctggtggtggagccgtacgcggtcaccgtgctgggcacgcaggcgctcaagctggcg
ggcggccaggacgcgctgctggagccggtggcgggcggcgcgctgaagctggccgtggcc
ttcggcgaaccgcagtcgcgctatgagctgttcaacgtgaccacgcgcgcggcgcagcag
ggtggcggctggacgctgtcgggcgccaaggccgtggtcgtgcatggcgggcaggccgac
aagctggtcgtgtcggcacgcacgggcggcgaggcgcgtgacacatcgggcctgtcgctg
ttcctggtcgatcgcgaggccgcgggcgtgacggtcaaggactaccgcaccatcgacaat
ctgcgcgccgctgacatccgcttcgacaatgcgccggccacgctgctcggcaaggccggc
gaggcgtgggagatcatcgatgcggtggcggatttcggctgcgtgctgctgtgcgccgag
gcgatcggcctgatcgacgcgctgaacgccgccacgctggaatacaccaagacgcgccag
cagttcggcgtgccgatcgcgcgtttccaggcgctgcagcaccgcatggtcgacatgttc
atccacgcggagcaggcgcgctcgatcacctatctcgcggcggcgcactttgaagacggc
gatgccgaggcacgccgccgttacgtgtcggccgccaaggcgcgcgtcggccaggcggcc
cgcgaagtgggccaggaggcggtgcagctgcacggcggcatgggcgtgaccaacgagctg
cccgccgcgcacatgttcaagcggctgacgatgatcaacaccacgctcggcgatgtcgat
catcacctggcgcgctttgcgtcgttgccgggtttccgcaacgccgcgtaa

DBGET integrated database retrieval system