KEGG   Ralstonia solanacearum PSI07: RPSI07_1405Help
Entry
RPSI07_1405       CDS       T01273                                 

Definition
(GenBank) Glutathione S-transferase with thioredoxin-like domain
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RPSI07_1405
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     RPSI07_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CBJ50766
LinkDB All DBs
Position
complement(1436879..1437571)
Genome map
AA seq 230 aa AA seqDB search
MIDVYSWATPNGHKVHIMLEECGLPYRVHAVNIGAGDQFKPEFLKISPNNKIPAIVDQDG
PDGKPISLFESGAILLYLAAKAGKFLPEDVRGKYEVLQWLMFQMGGVGPMLGQTHHFRVY
APEKIEYAINRYTNEAKRLYGVIDKRLAESKYLGGPDYSIADIATWPWLRSWQNQGIELS
DYPRLQRWFEAIEARPAVQRAVKVLAKERSPVQDDKAREVLFGATQYQRR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgtctacagctgggccacccccaacggacacaaggttcacatcatgctggag
gaatgcgggctgccctaccgcgtccatgccgtcaacatcggcgccggcgaccagttcaag
cccgagttcctgaagatcagcccgaacaacaagatcccggccatcgtcgaccaggacggg
ccggacggcaagccgatctcgctgttcgagtcgggggccatcctgctgtaccttgcggcc
aaggccggcaagttcctgcccgaggacgtgcgcggcaagtacgaggtgctgcagtggttg
atgttccagatgggcggcgtcggcccgatgctcggccagacgcatcacttccgcgtctac
gcgcccgagaagatcgaatacgcgatcaaccgctacaccaacgaggccaaacgcctatac
ggcgtgatcgacaagcgcctggcggaatccaagtacctgggcggccccgactactccatc
gccgacatcgccacctggccgtggctgcgcagctggcagaaccaggggatcgagctgtcg
gactaccccaggttgcagcgctggttcgaggccatcgaagcccgcccggccgtgcagcgc
gcggtgaaggtgctggccaaggaacgctcgcccgtgcaggacgacaaggcgcgcgaagtg
ctgttcggcgcgacgcaataccagcgccgctag

DBGET integrated database retrieval system