KEGG   Ralstonia solanacearum PSI07: RPSI07_1406Help
Entry
RPSI07_1406       CDS       T01273                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00071  Fatty acid degradation
rsl00280  Valine, leucine and isoleucine degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01130  Biosynthesis of antibiotics
rsl01212  Fatty acid metabolism
Module
rsl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_1406
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_1406
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     RPSI07_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: CBJ50767
LinkDB All DBs
Position
complement(1437713..1438975)
Genome map
AA seq 420 aa AA seqDB search
MNFDYSPKVKEMQARLLDFFDQHIYPNEHRFHEEVEANRRAGNAWIPTKVIEELKPLARQ
AGLWNLFLPRSPRAPEGLSNLEYAPLCEIMGRVPWAPEVFNCSAPDTGNMETLERYASDA
LKDRWLEPLLRGEIRSAFLMTEPAVASSDATNIECRIERQGDEYVINGRKWWSSGAGDPR
CAVYIVMGKTNPDAGRHGQQSMIVVPADTPGITVLRPLSVFGYDDAPHGHMEVDLKNVRV
PAANILLGEGRGFEIAQGRLGPGRIHHCMRSIGVAERALELMCKRLSSRIAFGKPIAQHS
VWHERIAEARCMIEQARLLTLKAAYMMDTVGNKVARAEIAMIKVVAPNIACQIVDWAIQA
HGGGGVSGDFPLASAYAHQRTLRLADGPDEVHRAAIAKLELAKHLHQLADVVDMPIARGA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgactactcgcccaaggtcaaggagatgcaggcccgcctgctcgacttcttc
gaccagcacatctatccgaacgagcaccgcttccacgaagaggtcgaagccaaccgccgc
gccggcaacgcctggatcccgaccaaggtgatcgaagaactcaagccgctggcgcgccag
gccgggctgtggaacctgttcctgccgcgctcgccgcgtgccccggaaggcctgtcgaac
ctcgaatacgcgccgctgtgcgagatcatgggccgcgtgccctgggcgcccgaggtgttc
aactgctcagcgccggacaccggcaacatggagacgctggagcgctacgcctccgacgca
ttgaaagaccgctggctcgagccgctgctgcgcggcgagatccgctcggcgttcctgatg
accgagccggccgtggcctcgtcggacgccaccaacatcgagtgccgtatcgagcgccag
ggcgacgaatacgtcatcaacggacgcaagtggtggtcctccggcgccggcgacccgcgc
tgcgcggtctacatcgtgatgggcaagaccaaccccgacgcgggccgccacgggcagcag
tcgatgatcgtggtgccggccgacacgccgggcatcaccgtcctgcgcccgctgtcggtg
ttcggctacgacgacgcgccgcacggccacatggaagtcgacctgaagaacgtgcgcgtg
ccggccgccaacatcctgctgggcgagggacgcggcttcgagatcgcgcagggccgcctg
ggcccgggccgcatccaccactgcatgcgcagcatcggcgtggccgagcgcgcgctggag
ctgatgtgcaagcgcctgtcgagccgcatcgccttcggcaagccgatcgcgcagcacagc
gtctggcacgagcgcatcgccgaggcgcgctgcatgatcgagcaggcgcgcctgctcacg
ctcaaggccgcctacatgatggacaccgtcggcaacaaggtcgcccgcgccgagatcgcg
atgatcaaggtggtggccccgaacatcgcctgccagatcgtcgactgggcgatccaggcg
cacggcggcggcggcgtgtcgggcgacttcccgctggcctcggcctacgcgcatcagcgc
acgctgcgcctggccgacggtccggacgaggtccaccgcgcggccatcgccaagctggaa
ctggccaagcacctgcaccagttggcggacgtggtcgacatgccgatcgcgcgcggcgcc
tga

DBGET integrated database retrieval system