KEGG   Ralstonia solanacearum PSI07: RPSI07_1425Help
Entry
RPSI07_1425       CDS       T01273                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00020  Citrate cycle (TCA cycle)
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
rsl01210  2-Oxocarboxylic acid metabolism
rsl01230  Biosynthesis of amino acids
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
rsl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_1425 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_1425 (acnA)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     RPSI07_1425 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: CBJ50786
LinkDB All DBs
Position
complement(1455140..1457845)
Genome map
AA seq 901 aa AA seqDB search
MPHNLKKTLKEFKINGSQTGKFYSLPQLGKELGVAIERLPVSIRIVLESVLRNCDGKKVT
DEHVAQLANWKPNADRVDEIPFVVARVVLQDFTGVPLLADLAAMRNVAERMGKNPKKIEP
LVPVDLVVDHSVQVDHFREKKALDLNMKLEFSRNNERYQFMKWGMQAFDTFGVVQPGFGI
VHQVNLEYLARGVHKKDGVFYPDTLVGTDSHTTMINGIGVVGWGVGGIEAEAGMLGQPVY
FLTPDVVGVELKGRLREGVTATDLVLTITELLRREKVVGKFVEFFGEGTASLSLPDRATI
GNMAPEYGATMGFFPVDEKTVDYFKGTGRTKDEIASFEAYFRAQKLFGVPKAGEIDYTKT
LTLDLSSVAPSLAGPKRPQDRIEIGNVKSTFSSLFSKPVAENGFNKKSDDLDKTFTTTNG
VDVKSGDVLIAAITSCTNTSNPSVLLAAGLLAKKAVEAGLTVAPHIKTSLAPGSRVVTKY
LEAAGLLPYLEKLGFGVTAYGCTTCIGNAGDLTPELNEAIVKNDIVAAAVLSGNRNFEAR
IHPNIRANFLASPPLVVAYAIAGNVTRDLMTEPVGKGKKGKDIYLGDIWPTSDEIAKLMK
FAMNADTFRTNYEQVKKPSKLWANVKGTKGQVYDWPKSTYIAEPPFFEGFGMTPAAASAS
VKGARALGVFGDSVTTDHISPAGSIKETSPAGKYLLANGVLKADFNSYGSRRGNHEVMMR
GTFANVRIKNLMIAARADGSRVEGGETLFQPSGEQMSIYDAAMKYVAEGTPTVVFGGEEY
GTGSSRDWAAKGTQLLGVKAVITRSFERIHRSNLVGMGVLPLQFKGNDSAQSLGITGDET
FDIEGLEGEIKPQQDVTLVITRANGDTKRVKVLLRIDTPIEVDYYKHGGILPFVLRQLLA
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgccccacaacctgaaaaaaacactcaaggaattcaagatcaacggcagccagaccggc
aagttctattccctgccgcagctgggcaaggaactgggcgtggcgatcgagcgcctgccg
gtttcgatccgcatcgtgctggagtcggtgctgcgcaactgcgacggcaagaaggtgacc
gacgagcacgtcgcccagctggccaactggaagccgaacgccgatcgcgtcgatgagatc
ccgttcgtggtcgcccgcgtggtgctgcaggacttcaccggcgtgccgctgctggccgac
ctggccgccatgcgcaacgtggccgagcgcatgggcaagaaccccaagaagatcgagccg
ctggtgccggtcgacctggtggtggaccactcggtgcaggtcgaccacttccgcgagaag
aaggcgctggacctgaacatgaagctggaattctcgcgcaacaacgagcgctaccagttc
atgaagtggggcatgcaggcattcgacacgttcggcgtggtgcagccgggcttcggcatc
gtccaccaggtcaacctggaatacctggcacgcggcgtccataagaaggacggcgtgttc
tacccggatacgctggtcggcaccgacagccacaccaccatgatcaacggtatcggcgtg
gtgggctggggcgtgggcggcatcgaggcggaagccggcatgctgggccagccggtgtac
ttcctgacgccggacgtggtgggcgtggagctcaagggccgcctgcgcgaaggcgtgacc
gccaccgacctggtgctcaccatcaccgaactgctgcgccgcgaaaaggtggtcggcaag
ttcgtcgagttcttcggcgaaggcacggccagcctgtcgctgccggaccgcgcgaccatc
ggcaacatggccccggaatacggcgcgaccatgggcttcttcccggtcgacgagaagacc
gtcgactacttcaagggcaccggccgcaccaaggacgagatcgcttcgttcgaagcctac
ttccgcgcgcagaagctgtttggcgtgcccaaggccggcgagatcgactacaccaagacg
ctcacgctggacctcagctcggtcgccccgtcgctggccggcccgaagcgcccgcaggac
cgcatcgagatcggcaacgtgaagtcgaccttctcgtcgctgttctccaagccggtggcc
gaaaacggcttcaacaagaagtcggatgacctggacaagaccttcaccaccaccaacggc
gtggacgtgaagagcggcgatgtgctgatcgctgccatcacctcgtgcaccaacacatcc
aacccgagcgtgctgctggccgctggcctgctggccaagaaggcggtggaagccggcctg
acggtcgccccgcacatcaagacctcgctcgccccgggaagccgcgtggtgacgaagtac
ctggaagccgccggcctgctgccgtacctggaaaagctgggcttcggcgtgacggcctat
ggctgcacgacctgtatcggcaacgccggcgacctgacgccggagctcaacgaagccatc
gtcaagaacgacatcgtggccgccgccgtgctgtcgggcaaccgcaacttcgaagcgcgc
atccacccgaacatccgcgccaacttcctggcctcgccgccgctggtcgtcgcctacgcg
atcgccggcaacgtgacgcgcgacctgatgaccgagccggtcggcaagggcaagaagggt
aaggatatctacctgggcgacatctggccgacctcggacgagatcgccaagctgatgaag
ttcgcgatgaacgccgacacgttccgcacgaactacgagcaggtcaagaagccgtccaag
ctgtgggccaacgtcaagggcacgaagggccaggtctacgactggccgaagtcgacgtac
atcgccgagccgccgttcttcgaaggcttcgggatgacgccggccgctgcatcggcatcg
gtcaagggcgcccgcgccctgggcgtgtttggcgattccgtgacgaccgaccacatctcc
ccggccggttcgatcaaggaaacctcgcccgccggcaagtacctgctggccaacggcgtg
ctcaaggccgacttcaacagctacggttcgcgccgcggcaaccatgaggtgatgatgcgc
ggcacgttcgccaacgtgcgcatcaagaacctgatgattgcggcccgcgctgacggttcg
cgcgtggaaggcggtgagacgctgttccagccgagcggcgagcagatgtcgatctatgac
gccgccatgaagtacgtcgccgaaggcacgccgacggtggtgttcggtggcgaagagtac
ggcacgggcagctcgcgcgactgggccgccaaaggcacgcagctgctgggcgtgaaggct
gtgatcacgcgcagcttcgagcgtatccaccgctcgaacctggtcggcatgggcgtgctg
ccgctgcagttcaagggcaatgactcggcacagtcgctgggcatcacgggcgacgagacc
ttcgacatcgagggcctggaaggcgaaatcaagccgcaacaggacgtcaccctggtgatc
acgcgtgccaacggcgacaccaagcgcgtgaaggtgctgctgcgcatcgacaccccgatc
gaagtcgactactacaagcacggtggtatcctgccgttcgtgctgcgtcagctgctggcc
gcgtaa

KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0134Help
Entry
RPSI07_mp0134     CDS       T01273                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase 1 protein
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00020  Citrate cycle (TCA cycle)
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
rsl01210  2-Oxocarboxylic acid metabolism
rsl01230  Biosynthesis of amino acids
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
rsl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_mp0134 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_mp0134 (acnA)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     RPSI07_mp0134 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: CBJ34493
LinkDB All DBs
Position
mpPSI07:154689..157364
Genome map
AA seq 891 aa AA seqDB search
MGNTYTPPQAVVSVGNVAYRVIDLPAMFGKTLERLPVVLRLLLENTLRNTEGRERQRAVE
GLLRWLEVGASEEEIAFQPARVLMHDTTSTPALVDIAAMRDALAEAGADPSVLNPVLPVD
VSVDHSLAVEYSARADAAVLNLQTEMRRNAERYRFLRWASKALRGVRIHPPGTGIMHTIN
LEQLATVASVQTLDGVPWLVPDTLIGTDSHTPMINGVGVLGWGVGGLEAQTVMFGMPVMQ
RIPDVIGVRLLGALPTGTSATDLALTVTKALRDIGVSGEFVEFFGPGVATLSAGERAVVA
NMAPEYGATTGFFPVDAQTLAYLRATGRPQAHVARVEALHRRAGLWFDPGNTPRYTRVVE
IDLAAVRLHVAGPRRPQDLLPYTDTGHALSAFDRTDAEAADGLPGHPVAIAAITSCTNTS
DPAQLIAAGLVARRARERGLRVPDWVKTSLAPGSPAAAEYLRRAGLMDDLSAVGFDIVGF
GCTTCIGNSGPLTAPIQQAIADGTAAPVAVLSGNRNFPGRVHPDLSLGFIMSPPLVIAFA
LAGDAARDLSRQPLQTAPDGTPVHLRDLWPTRAEIDTLVRRGTSPADYRHAFAIATANPA
WAAIDAPDAPRYPWDAGSTALRRPPFASADAGSQLGDYEAHPLLVLGDDITTDHISPASV
IPKDSFVADFLVARGDDRNDLNVFASRRGNWEVMVRAAFYSKTLVNLLAPGLPVAHTLHV
PSGQAMPVFEAAQRYRDDGASVVVLAGARYGTGSSRDWAAKGQRLLGVRAVIAVSFERIH
RSNLIGMGILPLRFPEGVSPRTLAIRPGDTIQVAARPERIGPRCAVPVRVRRADGSVETF
IATAAVETQLETALLRGGGVIPAILDKTLQTQRAAAQAEPQQAASPHSPMP
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacctacacgcctccccaagcggtggtgagcgtcggcaacgtcgcttaccgg
gtcatcgatctgcccgcgatgttcggcaagacgctcgagcggctgccggtcgtgctgcgg
ctgttgctggagaacaccctccgcaacacggaaggccgagagcggcagcgcgctgtcgag
ggcctgctgcgctggctggaggtgggcgcgagcgaagaggagatcgcattccagcccgcc
cgcgtgttgatgcacgacaccacgagcacgccggcgctggtcgatatcgccgccatgcgc
gatgcgctggcggaggcaggggccgacccgtcggtgctgaacccggtgctgccggtggat
gtgtcggtcgatcactcgctggcggtcgaatacagcgcacgcgcggatgcagccgtgctg
aacctgcagacggaaatgcggcgcaacgccgagcgctaccgcttcctgcgctgggcctcg
aaggcgctgcgcggcgtgcgcatccatccgccgggcacggggatcatgcatacgatcaac
ctggagcaactggccaccgtcgcctcggtccagaccctcgacggcgtgccctggctggtg
cccgatacgctgatcggcaccgacagccatacgccgatgatcaacggcgtcggcgtgctg
ggctggggcgtgggcgggctggaggcgcagaccgtcatgttcggcatgccggtcatgcag
cgcattcccgatgtgatcggtgtgcgcctgctgggcgcgctgcccaccggcacgtcggcc
actgacctggcgctgacggtcaccaaggctctgcgcgacatcggcgtcagcggcgagttt
gtcgagttcttcggccctggcgttgccacgctgagcgccggcgagcgcgcggtcgtcgcc
aacatggcgcccgaatatggcgccaccaccggcttcttcccggtcgatgcgcagacgctg
gcctatctgcgcgccaccgggcggccgcaagcgcacgtcgcgcgggtcgaggcgctgcat
cggcgcgcgggcctgtggttcgatccgggcaacacgccgcgctatacgcgcgtggtcgag
atcgatctggcggcggtgcggctgcacgtggcgggcccgcgccgcccgcaggacctgctg
ccctataccgacacggggcatgccttgtcggccttcgacaggacggatgccgaagccgcc
gacgggctgccgggccacccggtggccatcgccgccatcaccagctgcaccaatacatcc
gacccggcccagctcatcgcggcagggctggtggcgcggcgcgcgcgcgagcgcggactg
cgtgttcccgactgggtcaagacctcgctggcgccgggctcgcccgccgccgccgaatac
ctgcggcgcgccgggctcatggatgacctgtccgcggtggggttcgatatcgtcgggttt
ggctgcaccacgtgcatcggcaattccggcccgctgaccgcgcccatccagcaggccatc
gcggacggcacggcggcgccggtggcggtgctgtcaggcaaccgcaatttcccggggcgg
gtgcatccggatctcagcctcggcttcatcatgtcgccgccgctggtgatcgccttcgcg
ctggccggcgacgcggcgcgcgacctgagccggcaaccgctgcagacggcgcccgacggc
acgccggtccatctgcgggacctttggccgacgcgcgcggaaatcgatacgctggtccgg
cgcgggacatcgcccgccgactatcggcacgcctttgccatcgcgaccgccaatccggca
tgggcggccatcgacgcgcccgatgcgccgcgctatccctgggacgccggctcgactgcc
ctgcgccgtccgcccttcgcgtcggccgatgccggcagccagctcggcgactacgaggcc
catccgctgctggtgctgggcgacgacatcacgaccgatcacatctcgcctgccagcgtc
atcccgaaggacagcttcgtcgcggacttcctcgtcgcccgcggggacgatcgcaacgac
ctcaacgtgttcgcctcccggcgcggcaactgggaagtgatggtgcgcgcggcgttctac
agcaagacgctggtcaacctgctggcgcccggcctgccggtggcacatacgctgcacgtg
cccagcgggcaggcgatgccggtcttcgaggccgcgcagcgctatcgcgacgacggcgca
tcggtggtggtgctggcgggggcccggtacggtacgggttcatcgcgcgactgggccgcc
aaggggcagcgcctgctcggtgtgcgggcggtcattgcggtaagcttcgagcgcattcac
cgttccaacctgatcggcatgggcatcctgccgctgcgcttccccgagggggtgagtccg
cggacgctggccatccgcccgggcgatacgatccaggtcgcggcccggccggagcggatc
ggcccgcgctgcgcggtgcccgtccgcgtgaggcgggcggacggcagcgtggagaccttc
atcgcgacggccgccgtggaaacgcagctcgagaccgcgttgctgcgcggcggcggcgtg
atccctgcgatcctggacaagacgctgcagacgcagcgtgccgccgcgcaggccgagccg
cagcaggctgcctcgccgcattcaccaatgccatga

DBGET integrated database retrieval system