KEGG   Ralstonia solanacearum PSI07: RPSI07_1426Help
Entry
RPSI07_1426       CDS       T01273                                 

Gene name
prpD
Definition
(GenBank) 2-methylcitrate dehydratase
  KO
K01720  2-methylcitrate dehydratase [EC:4.2.1.79]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RPSI07_1426 (prpD)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.79  2-methylcitrate dehydratase
     RPSI07_1426 (prpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: CBJ50787
LinkDB All DBs
Position
complement(1457902..1459353)
Genome map
AA seq 483 aa AA seqDB search
MSAPAANIRPKPDKVIVDIVDYVTAFRIDSKAAYETARHCLLDTLGCGLEALSYPACTKL
LGPVVPGTIVPNGAKVPGTPFQLDPVQAAFSIGAMIRWLDFNDTWLAAEWGHPSDNLGGI
LAVADWLSRTRIAGGKTPLVMKDVLTAMIQAHEIQGCIALENAFNKVGLDHVVLVKVATA
AVVGQLLGLSREDIINAVSLAWVDGQALRTYRHAPNTGSRKSWAAGDATSRGVRLALIAK
TGEMGYPSALTSKDWGFYDVSFKGKPFTFQRPYGTYVMENVLFKISFPAEFHAQTAAEAA
MTLHRALAKAGRSVDDIKTITIRTHEAALRIIDKTGPLSNPADRDHCLQYMVAVPLIFGR
LTAEDYEDSVAHDPRIDALRKKMVCVEDKQFTKDYHDPKKRSIANALTVAFKDGKTLKEV
VVEYPIGHQRRRKEGMPLLVEKFRTNLARRFPAKQQDAILRASLDQKALEAMPVNEYVDL
YVI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgccagctgcgaacatccgcccaaaacccgacaaggtcatcgtcgacatcgtc
gactatgtgaccgcgttcaggatcgacagcaaggcagcctacgagacggcccgccattgc
ctgctcgacacgctgggttgcgggctggaggcgctgtcgtatccggcgtgcaccaagctc
ctgggcccggtcgtgccagggaccatcgtgccgaacggcgcgaaggttccgggcacgccg
ttccagctcgatccggtgcaggcggcgttcagcatcggtgccatgatccgctggctggac
ttcaacgacacctggctcgcggcggaatggggccacccgtcggacaacctcggcggcatc
ctggccgtggcggactggctttcccgcacccgcatcgccggcggcaagacgccgctcgtg
atgaaggacgtgctgaccgcgatgatccaggcccacgagatccagggctgcattgcgctc
gaaaacgcattcaacaaggtgggactggaccacgtggtgctggtcaaggtcgccaccgcc
gcggtggtcgggcaactgctcggcctgtcgcgcgaagacatcatcaacgcggtgtcgctg
gcctgggtcgacggccaggcgctgcgcacctaccgtcacgcgcccaatacgggcagccgc
aagtcatgggcggcgggcgatgccaccagccgcggcgtgcgcctggcgctgatcgccaaa
accggcgagatgggctacccctccgccctcacctcgaaggactggggcttctacgacgtg
tcgttcaagggcaagccgttcacgttccagcgcccttacggcacgtatgtgatggaaaac
gtgctgttcaagatcagctttccggccgagttccacgcgcagaccgccgccgaagccgcg
atgacgctgcatcgggcccttgccaaggcaggcaggtccgtcgacgacatcaagacgatc
acgatccgcacgcacgaagcggcgctgcgcatcatcgacaagaccggcccgctcagcaac
cctgccgaccgcgaccactgcctccagtacatggtcgccgtgccgctgatcttcggccgc
ctgacggccgaggattacgaagacagcgtcgcccacgacccacgcatcgatgcgctgcgc
aagaagatggtctgcgtggaagacaagcagttcaccaaggattaccacgacccgaagaag
cgttcgatcgccaacgcgctcaccgtcgcgttcaaggacggcaagacgctcaaggaggtc
gtggtggagtacccgatcggccatcagcggcggcgcaaggaaggcatgccgctgctggtc
gagaagttcaggaccaacctggcccgccgctttccggccaagcagcaggacgccatcctg
cgcgcctcgctggaccagaaagcgctcgaagccatgccggtcaacgagtatgtcgatttg
tacgtgatttga

DBGET integrated database retrieval system