KEGG   Ralstonia solanacearum PSI07: RPSI07_1693Help
Entry
RPSI07_1693       CDS       T01273                                 

Gene name
pdhL
Definition
(GenBank) dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate dehydrogenase complexes
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00020  Citrate cycle (TCA cycle)
rsl00260  Glycine, serine and threonine metabolism
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00380  Tryptophan metabolism
rsl00620  Pyruvate metabolism
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_1693 (pdhL)
   00020 Citrate cycle (TCA cycle)
    RPSI07_1693 (pdhL)
   00620 Pyruvate metabolism
    RPSI07_1693 (pdhL)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_1693 (pdhL)
   00640 Propanoate metabolism
    RPSI07_1693 (pdhL)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_1693 (pdhL)
   00280 Valine, leucine and isoleucine degradation
    RPSI07_1693 (pdhL)
   00310 Lysine degradation
    RPSI07_1693 (pdhL)
   00380 Tryptophan metabolism
    RPSI07_1693 (pdhL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsl04147]
    RPSI07_1693 (pdhL)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     RPSI07_1693 (pdhL)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RPSI07_1693 (pdhL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox GIDA FAD_oxidored Biotin_lipoyl_2 GCV_H AlaDh_PNT_C Pyr_redox_3 NAD_binding_8 FAD_binding_2 PYNP_C Thi4 DEC-1_N HlyD_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBJ51054
LinkDB All DBs
Position
1710780..1712546
Genome map
AA seq 588 aa AA seqDB search
MSVVEIKVPDIGDYKDVDVIEVMVKAGDAVTVDQPLITLETDKATMDVPADVAGKIVEVK
IKVGDKVSQGTVIATVEAGAAAAQAPAPVAAAPAASAPAPAPQAAKHSGSADIECDMLVL
GSGPGGYSAAFRSADLGMNTVLVERFGTLGGVCLNVGCIPSKALLHTAAIMDEVKAMASH
GIVYSEPKVDLDQLRKHKEAVVGKLTGGLAGMAKSRKVQVVRGVGTFLDPNHLEVQLTTG
DGKQPTGEKTVIRFAKAIIAAGSESVKLPFIPEDPRIVDSTGALELRQVPGKMLVIGGGI
IGLEMATVYSTLGARIDVVEMLDSLMNGADRDLVKVWDKMNKSRFDKVMLKTKTVGVEAK
PDGIYVKFEGEQAPAEPQRYDMVLVAVGRSPNGKRIGAEKAGVAVTDRGFIDVDKQQRTN
VPHIYAIGDIVGQPMLAHKAVHEAHVAAEAAHGEKAYFDAKQIPSVAFTDPEVAWAGLTE
DQCKAQGIKYGKGVFPWAASGRAIANGRDEGFTKVIFDEETHRIIGGGIVGTHAGDLISE
ICLAIEMGADAIDIGKTIHPHPTLGESVGMAAEIYEGVCTDVPPARKR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtggaaatcaaggtgccggacatcggcgactacaaggacgtggacgtcatc
gaagtgatggtgaaggcgggcgacgccgtcaccgtcgaccagccgctgattacgctggaa
accgacaaggcgaccatggacgtgccggccgacgtggcgggcaagatcgtcgaggtcaag
atcaaggtgggcgacaaggtcagccagggcaccgtcatcgccacggtggaagccggtgct
gcggcggcgcaagctccggctccggtggctgccgccccggccgcatcggctccggcgccc
gcgccgcaggccgccaagcacagcggcagcgccgacatcgaatgcgacatgctcgtcctg
ggctccggcccgggcggctactcggccgctttccgcagcgctgacctcggcatgaacacc
gtgctggtcgaacgcttcggcacgctgggcggcgtctgcctgaatgtggggtgcatcccg
tccaaggcgctgctgcacacggccgccatcatggatgaagtcaaggcgatggccagccat
ggcatcgtctacagcgagccgaaggtcgatctggaccagctgcgcaagcacaaggaagcg
gtggtcggcaagctgaccggcggcctggccggcatggccaagtcgcgcaaggtgcaggtg
gtgcgcggcgtcggcaccttcctcgacccgaaccacctcgaagtccagctgaccacgggc
gacggcaagcagccgaccggtgagaagacggtcatccgcttcgccaaggccatcatcgcg
gccggcagcgaatcggtgaagctgccgttcattccggaagacccgcgcatcgtcgactca
accggcgcgctggagctgcgtcaggtgcccggcaagatgctggtcatcggcggcggcatc
atcggcctggaaatggcaacggtctacagcacgctgggcgcgcgcatcgacgtggtggag
atgctcgatagcctgatgaacggcgccgaccgcgatctcgtcaaggtgtgggacaagatg
aacaagtcccgcttcgacaaggtcatgctcaagaccaagacggtgggtgtcgaggccaag
ccggacggtatctacgtcaagttcgagggcgagcaggcgcccgccgagccgcagcgctac
gacatggtgctggtggccgtgggccgcagcccgaacggcaagcgcatcggcgcagaaaag
gccggcgtggccgtgaccgaccgcggcttcatcgacgtggacaagcagcagcgcaccaac
gtaccgcacatctacgcgatcggcgacatcgtcgggcagccgatgctggcgcacaaggcg
gtgcacgaggcccatgtcgcggcggaggccgcgcatggcgagaaggcgtacttcgatgcc
aagcagattccgtcggtggccttcaccgacccggaagtggcctgggccggcctgaccgaa
gaccagtgcaaggcgcagggcatcaagtacggcaagggcgtgttcccgtgggccgcttcg
ggccgcgccatcgccaacggtcgcgacgagggcttcaccaaggtcatcttcgacgaggag
acgcaccggatcatcggcggcggcatcgtcggcacgcacgcaggcgacctgatcagcgaa
atctgcctggcgatcgagatgggcgcggacgcgatcgacatcggcaagaccatccacccg
cacccgacgctgggcgagtcggttggtatggcggcggaaatctacgagggcgtctgtacg
gacgtgccgccggctcgtaagcgctga

KEGG   Ralstonia solanacearum PSI07: RPSI07_2094Help
Entry
RPSI07_2094       CDS       T01273                                 

Gene name
lpdA
Definition
(GenBank) Dihydrolipoamide dehydrogenase (component of pyruvate and 2-oxoglutarate dehydrogenases complexes) oxidoreductase protein
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00020  Citrate cycle (TCA cycle)
rsl00260  Glycine, serine and threonine metabolism
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00380  Tryptophan metabolism
rsl00620  Pyruvate metabolism
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl00640  Propanoate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_2094 (lpdA)
   00020 Citrate cycle (TCA cycle)
    RPSI07_2094 (lpdA)
   00620 Pyruvate metabolism
    RPSI07_2094 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_2094 (lpdA)
   00640 Propanoate metabolism
    RPSI07_2094 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_2094 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    RPSI07_2094 (lpdA)
   00310 Lysine degradation
    RPSI07_2094 (lpdA)
   00380 Tryptophan metabolism
    RPSI07_2094 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsl04147]
    RPSI07_2094 (lpdA)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     RPSI07_2094 (lpdA)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RPSI07_2094 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA HI0933_like FAD_binding_2 AlaDh_PNT_C Pyr_redox_3 FAD_oxidored 3HCDH_N NAD_binding_8 FAD_binding_3 2-Hacid_dh_C Lycopene_cycl Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: CBJ51459
LinkDB All DBs
Position
complement(2188139..2189575)
Genome map
AA seq 478 aa AA seqDB search
MSKEFDVLVIGAGPGGYIAAIRAGQLGLNVACCEDNPYDDPKGEPRLGGTCLNVGCIPSK
ALLASSEEFENVNHHLADHGITVEGAKVDVTKMLKRKDDIVGKMTKGIEFLFRKNKVTLL
KGHGKFVGKTDAGYQVEVSGKAGAEVVTAKHVIIATGSKARHLPGVPVDNVTIADNEGAL
KFGGVPKKLGVIGAGVIGLELGSVWRRLGSEVTILEALPSFLGAADESVAKEANKLLTKQ
GLNIKVGVQVGEIQSSDQGVKVNYTDAAGAAQVLECDKLIVSIGRVPNTDNLGLDAIGLA
ADQRGFIEVDDHCATKLPNLWAIGDVVRGPMLAHKAEDEGVAVAERIVGQKPHIDYNCIP
WVIYTYPEIAWVGKTEQQLKAEGRETKAGQFPFMANGRALGMGASDGFVKIIADAKTDEI
LGVHVVAANASDLIAEAVVAMEFKAAAEDIGRICHPHPSMSEVMREAALAVDKRQLNM
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaatttgacgtgctggtgatcggcgccggccccggtggctatatcgccgcc
atccgtgccggccagctgggcctgaacgtggcctgctgcgaagacaatccctacgacgat
ccgaagggcgagccgcgcctgggcggcacctgcctgaacgtcggctgcattccgtccaag
gcgctgctggcctcgtcggaggagttcgagaacgtgaaccaccacctggccgaccatggc
atcacggtggaaggtgcgaaggtcgatgtcaccaagatgctcaagcgcaaggatgacatc
gtcggcaagatgaccaagggcatcgagttcctgttccgcaagaacaaggtgacgctgctc
aagggccacggcaagttcgtcggcaagacggatgcgggctaccaagtggaagtcagcggc
aaggccggcgcggaagtcgtgaccgccaagcacgtgatcatcgccaccggctcgaaggcc
cgccacctgccgggcgtgccggtcgacaacgtgaccatcgccgataacgaaggcgcgctg
aagttcggcggagtgccgaagaagctgggcgtgatcggcgccggcgtgatcggcctggaa
ctgggctcggtgtggcgccgtctgggttccgaagtgaccattctcgaagcgctgccgagc
ttcctgggcgcagcggacgagtcggtggccaaggaagccaacaagctgctgaccaagcag
ggcctgaacatcaaggtcggcgtgcaggttggtgagatccaatcgagcgatcagggcgtc
aaggtgaactacaccgacgccgccggcgccgcccaggtgctggagtgcgacaagctgatc
gtgtcgatcgggcgcgtgccgaacaccgacaacctgggcctggatgcgatcggcctggcg
gcggatcagcgcggtttcatcgaggtggacgaccactgcgcgaccaagctgccgaacctg
tgggcaatcggcgacgtggtgcgtggcccgatgctggcgcacaaggccgaagacgaaggc
gtggccgtggccgaacgcatcgtcggccagaagccgcacatcgactacaactgcattccg
tgggtcatctacacgtacccggaaatcgcgtgggtcggcaagaccgaacagcagctcaag
gccgaaggccgcgagaccaaggcgggccagttcccgttcatggccaatggccgtgcgctg
ggtatgggcgcgtcggacggcttcgtcaagatcatcgccgatgccaagaccgacgagatc
ctcggcgtgcacgtggtggccgccaacgcgtcggacctgatcgccgaagccgtggtagcg
atggagttcaaggctgcggcggaagacatcggccgcatctgccacccgcatccgtcgatg
tccgaagtgatgcgcgaggctgcgctggctgtcgacaagcgtcagctgaacatgtaa

DBGET integrated database retrieval system