KEGG   Ralstonia solanacearum PSI07: RPSI07_1913Help
Entry
RPSI07_1913       CDS       T01273                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rsl  Ralstonia solanacearum PSI07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh NolV
Motif
Other DBs
NCBI-ProteinID: CBJ51276
UniProt: D8NTW0
LinkDB All DBs
Position
complement(1987835..1989271)
Genome map
AA seq 478 aa AA seqDB search
MQQRDKLFINGQWVAPQGKGVIDVIHSTTEAVMGTIPEGSAADAEAAVAAARAAFDGWSA
TPAPKRAETIQKIAEGLKARSEELAQLIAGEVGMPIKLARAIQVGGPVYNWGNFAKLLGS
FAFEERVGNSLVVREPVGVVGAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
VLAEVIEAAGLPPGVFNLVTGYGPVVGEVLASHPEVDMVSFTGSTRAGKRVAELASQTVK
RVALELGGKSASLILDDADLAAAVKGTLSACFLNSGQTCSAHTRMLVPRARYEEVKALAR
QLAAIYVPGDPAQESTRLGPLISAVQRDRVLGYIRKGLEEGAELITGGPEKPDGVSTGYF
VRPTVLGNVRPSDTVAREEIFGPVLTILCYDDEDEAIRLANDSIYGLSGGVWSGDEARAI
RVARRIRTGQVNINGGPFNMLAPFGGYKQSGNGRENGKYGLEEFLEYKALQLKPEQAA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacgcgacaaactgttcatcaacggccaatgggtggcgccgcagggcaagggc
gtcatcgacgtgattcattcgacaaccgaagccgtgatggggaccatccccgaaggcagc
gccgccgatgccgaagccgccgtggcggcggcccgggcggcgttcgacggctggtcggcc
acgcctgcgcccaagcgtgccgaaaccatccagaagatcgccgagggcttgaaggcccgc
agcgaagaactcgcccagctgatcgccggcgaagtcggcatgccgatcaagctggcgcgc
gccatccaggtcggcggcccggtctacaactggggcaacttcgccaagctgctcgggtcg
ttcgcgttcgaggagcgtgtcggcaattcgctggtggtgcgcgagccggtgggcgtggtg
ggggccatcacgccgtggaactatccgctcaaccagatcacgctgaaggtggcgccggcg
ctggcggccggctgcacggtggtgctcaagccgtcggaggtggcgccgctcaatgccttt
gtgctggccgaggtcattgaagccgccggcttgccgccgggcgtgttcaacctcgtcacc
ggctatggtccggtggtgggcgaggtgctggcgagccacccggaggtcgacatggtgtcg
ttcacggggtcgacgcgcgcgggcaagcgggtggccgagctggcctcgcagacggtcaag
cgcgtggcgctggagctgggcggcaagtcggcttcgctgatcctggacgatgccgacctg
gccgcggcggtcaagggcacgctgtcggcgtgcttcctgaactccggccagacctgctcg
gcccacacccgcatgctggtgccacgcgccaggtacgaggaggtgaaggccctggcgcgg
caattggcagcgatctatgtgccgggcgatccggcgcaggagagcacgcggctcggcccg
ctgatttcggccgtgcagcgcgatcgcgtgctgggctacatccgcaaggggctggaggag
ggggccgagctcatcaccggcggcccggagaagccggacggcgtgtcgaccggctacttt
gtccggccgaccgtgcttggcaatgtcaggccgtccgacacggtggcgcgggaggagatc
ttcgggccggtgctgaccattctctgctacgacgacgaggacgaggccatccggctcgcc
aacgacagcatctatgggctgagcggcggcgtgtggtcgggcgacgaagcgcgggcgatc
cgcgtggcgcggcgcatccgcaccgggcaggtgaacatcaacggcgggccgttcaacatg
ctggcaccgttcggcggctacaagcagtccggcaacgggcgcgagaacggcaagtacggg
ctggaggagttcctggagtacaaggcgctgcagctcaagcccgagcaggcggcctga

DBGET integrated database retrieval system