KEGG   Ralstonia solanacearum PSI07: RPSI07_2526Help
Entry
RPSI07_2526       CDS       T01273                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RPSI07_2526 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsl02000]
    RPSI07_2526 (gst)
Enzymes [BR:rsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPSI07_2526 (gst)
Transporters [BR:rsl02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPSI07_2526 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_N_4 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: CBJ51892
UniProt: D8NWT4
LinkDB All DBs
Position
complement(2656219..2656839)
Genome map
AA seq 206 aa AA seqDB search
MKLYYFPGACSLSPHIVAREAGIVLQLVKVDIRAKRTEHGEDFHGINPKGAVPVLELDSG
ERLTEGTAIVQYLADLKPESGLAPANGTMARYRLQEWLGCINSELHKSYSPLFNPSTPET
VRQERKDALRRHYALVEQHLAAHPWLLGERFTAADAYLFTVTNWAGHVGLDLSAFTALAA
FQQRVAERPAVLAALEAEGLLSEAGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctattactttcccggagcctgttcactctcgccgcacatcgtggcgcgcgag
gcgggcattgttctgcaactggtcaaggtcgacatccgggccaagcgcacggaacacggt
gaagacttccacgggatcaaccccaagggggccgtgccggtcctcgaactggacagcggc
gagcggctgacggaaggcacggcgatcgttcagtaccttgcagacctgaagccggaaagc
ggcctggcacccgccaacggcacgatggcacgctatcgcctgcaggaatggctgggctgc
atcaactcggaactgcacaagagctactcgccgctcttcaatccgtccacgcccgagacg
gtccggcaggagcgcaaggatgccctgcgcaggcactacgcgctggtggagcagcacttg
gcagcccatccctggctgctgggcgaacgtttcacggcggcagacgcctatctgttcacg
gtcaccaactgggcggggcacgtgggcctcgatctgtcggcattcacggcgttggctgcg
ttccagcagcgcgttgcggagcggccggcggtgctggctgcgctggaggcggaggggttg
ttgagcgaggcgggggcgtaa

DBGET integrated database retrieval system