KEGG   Ralstonia solanacearum PSI07: RPSI07_2897Help
Entry
RPSI07_2897       CDS       T01273                                 

Definition
(GenBank) putative CoA TRANSFERASE; exported protein
  KO
K01026  propionate CoA-transferase [EC:2.8.3.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl00643  Styrene degradation
rsl01100  Metabolic pathways
rsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_2897
   00640 Propanoate metabolism
    RPSI07_2897
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    RPSI07_2897
Enzymes [BR:rsl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.1  propionate CoA-transferase
     RPSI07_2897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al AcetylCoA_hydro
Motif
Other DBs
NCBI-ProteinID: CBJ52260
LinkDB All DBs
Position
complement(3030246..3031910)
Genome map
AA seq 554 aa AA seqDB search
MQVITAEEAARLVQPGWTVACAGFVGAGHAEAVTHALERRFLATGEPRDLTLVYSAGQGD
RATRGVNHFGNPGMTRCVVGGHWRSATRLAALALAEQCEAFNLPQGVLTHLYRAIAGGKP
GVLTRIGLHTFVDPRTSLDARYHGAAINARARAAREAGTASWVEYERFRGEDYLFYPRFP
LHGVFLRGTAADPRGNISTHEEAFHHELLAMAQAARNAGGIVIAQVRRLVDRHDNLQAIH
VPGILVDYVVVAEDPAEHQMTFGEAFNPTYLRPWQGEAIQLREDALEAGAAIETSLHGAL
DARTLVQRRAVLELMAQRPRVVNLGVGMPAAVGALAEQEGARGFTLTVEAGPIGGTPADG
LSFGASAYPEAVVDQPAQFDFYEGGGIDLAILGLAELDGQGNVNVSLFGEGDDTIVAGVG
GFINITQSARALVFMGTLTAGGLQVEAGDGRLRIVREGRLKKIVPAVSHLTFNGAYAARS
GIPVRYVTERAVFEMRDDGHGGRRLTLTEIAPGIDLQRDVLDQCAAEVAVAADLREMDHR
IFRRGPMCAGPAAA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatcacagcggaggaagcggcgcggctggtgcagccgggctggacggtggcg
tgtgccggcttcgtcggcgcgggccacgcggaggcggtgacgcacgcgctggagcgacgc
ttcctggcgaccggcgagccgcgcgatctcacgctggtgtactccgccggccagggcgat
cgcgccacgcgcggcgtcaaccacttcggcaaccccggcatgacgcgctgcgtggtcggc
ggccattggcgctcggcgacgcggctggcggcgttggcgctggccgagcagtgcgaggcc
ttcaatctcccgcagggcgtgctgacgcacctgtaccgcgccatcgccgggggcaagccg
ggcgtgctgacccggatcggcctgcatacctttgtcgatccgcgcacctcgctcgacgcg
cgctaccacggcgcggccatcaatgcgcgtgcccgggcggcccgcgaggccggcaccgcg
tcgtgggtcgagtacgagcgctttcgcggcgaggactatctgttctatccgcgcttcccg
ctgcatggcgtctttctgcgcggcacggcggccgacccgcgcggcaacatcagcacgcac
gaagaagccttccaccacgaactgctggcgatggcgcaggccgcgcgcaatgcgggcggc
atcgtcatcgcgcaggtgcggcggctggtggaccggcacgacaacctgcaggcgatccac
gtgccgggcatcctggtcgactacgttgtcgtggccgaggaccccgccgaacaccagatg
acgttcggcgaggcgttcaacccgacctatctccggccctggcagggcgaggcgatccag
ctgcgcgaagacgcacttgaagccggcgcggcgatcgagaccagcctgcatggcgcactc
gatgcccgcacgctggtgcagcggcgcgcggtgctggagctgatggcgcagcggccgcgc
gtggtgaacctgggcgtgggcatgcccgccgccgtgggcgcgctggccgagcaggaaggc
gcgcgcggcttcacgctgaccgtcgaggccgggccgatcggcggcacgccggcggacggg
ctgagcttcggcgcatccgcctatccggaggcggtggtcgatcagccggcgcagttcgat
ttctatgagggcggcggcatcgacctcgccatcctcggtctggccgaactcgacgggcag
ggcaatgtcaacgtcagcctgttcggcgaaggcgatgacacgatcgtcgcgggtgtcggc
ggcttcatcaacatcacgcagagcgcgcgggccctggtgttcatgggcacgctcacggcc
ggcggcctgcaggtggaggccggggatggccgcctgcgcatcgtgcgcgaagggcgcctg
aagaagatcgtgccggccgtgtcgcacctgaccttcaacggcgcgtacgcggcgcgctcc
ggcatcccggtgcgctacgtgaccgagcgcgcggtctttgagatgcgcgacgacggccac
ggcgggcgccggctgacgctcacggaaatcgcccccggcatcgacctgcagcgcgacgtg
ctcgaccagtgcgccgccgaggtggccgtggcggccgacttgcgcgagatggaccaccgc
atcttccgtcgtggtccgatgtgcgccggaccggcggcggcatga

DBGET integrated database retrieval system