KEGG   Ralstonia solanacearum PSI07: RPSI07_3363Help
Entry
RPSI07_3363       CDS       T01273                                 

Gene name
pckG
Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00020  Citrate cycle (TCA cycle)
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
Module
rsl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_3363 (pckG)
   00020 Citrate cycle (TCA cycle)
    RPSI07_3363 (pckG)
   00620 Pyruvate metabolism
    RPSI07_3363 (pckG)
Enzymes [BR:rsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     RPSI07_3363 (pckG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N
Motif
Other DBs
NCBI-ProteinID: CBJ52710
LinkDB All DBs
Position
complement(3496773..3498641)
Genome map
AA seq 622 aa AA seqDB search
MNQPVMQGIPALNVPEYVKHAQLVAWVGEIAALTKPERVVWCDGSQEEYDRLCAEMVAAG
TLKQLNPAKRKNAYLALSDPSDVARVEDRTFICSQKEEDAGPTNNWIAPAEMRQTLGGLF
DGCMRGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVAVNMRIMTRMGRAVFDVLGADGEF
VPCVHTVGKPLAAGEKDVPWPCNPTKYIVHFPETREIWSFGSGYGGNALLGKKCFALRIA
STMGRDQGWLAEHMLILGVTSPEGKTYHVAAAFPSACGKTNFAMLIPPAGFNGWKVTTIG
DDIAWIKPRQGADGTTRLYAINPEAGYFGVAPGTSEKTNYNAMATLKENVIFTNVALTDD
GDVWWEGMTDAPPAHLIDWQGQDWTPEIAKQTGRKAAHPNARFTAPAAQCPSIDPEWDNP
AGVPIDAFIFGGRRSTTVPLVTEARDWTEGVYMAATMGSETTAAAAGQQGVVRRDPFAML
PFCGYNMADYFAHWLKLGDQLAKSGATLPKIFCVNWFRKDEQGRFVWPGFGENMRVLKWM
IDRIEGQVRGDEHVFGVSPRYEELRWDGLDFSAEQFAKVISLDAQAWKQELALHAELFAQ
LAHHLPQALPEAKARLEGRLQG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacccgtgatgcagggcattccagcattgaacgtgcccgagtacgtgaagcac
gcgcaactggtggcgtgggtcggcgagattgccgcgctcaccaagccggaacgcgtggtc
tggtgcgatggttcgcaggaggaatacgaccgcctgtgcgccgaaatggtcgccgccggc
acgctgaagcagctcaaccccgccaagcgcaagaatgcgtacctggcgctgtccgacccg
tcggacgtggcgcgcgtggaggatcggaccttcatctgctcgcaaaaagaggaagacgcg
ggcccgaccaacaactggatcgccccggccgagatgcgccagacgctgggcggcctgttc
gacggctgcatgcgcggccgtacgctgtacgtggtgccgttttcgatgggcccgctgggc
tcgccgatcgcgcacatcggcgtggagctgtccgatagcccgtatgtggccgtcaatatg
cgcatcatgacccgcatgggccgcgccgtgttcgacgtgctgggcgctgatggcgagttc
gtgccgtgtgtgcatactgtcggcaagccgctggccgcgggcgagaaggatgtgccgtgg
ccgtgcaacccgaccaagtacatcgtgcacttcccggaaacgcgcgagatctggtcgttc
ggttcgggctacggcggcaacgcgctgctgggcaagaagtgcttcgcgctgcggatcgct
tccaccatgggccgcgaccagggctggctggccgagcacatgctgatcctgggcgtgacc
tcccccgagggcaagacttaccacgtggccgcggccttcccgtcggcttgcggcaagacc
aacttcgcgatgctgatcccgccggccggcttcaacggctggaaggtcaccacgatcggc
gacgacatcgcctggatcaagccgcgccagggtgccgacggcacgacgcgcctgtacgcc
atcaacccggaagcgggctatttcggcgtggccccgggcaccagcgagaagaccaactac
aacgcgatggcgaccctcaaggaaaacgtcatcttcaccaacgttgcgctcaccgatgac
ggcgatgtgtggtgggaaggcatgaccgacgccccgcccgcgcacctgatcgactggcaa
ggccaggactggacgcccgagatcgccaagcagaccggtcgcaaggccgcgcacccgaac
gcgcgcttcacggcgccggccgcgcagtgcccgtcgatcgacccggaatgggacaacccc
gccggcgtgccgatcgatgccttcatcttcggcggccgtcgttccacgacggtgccgctg
gtgaccgaagcccgcgattggaccgaaggcgtctacatggctgccacgatgggctcggaa
accaccgccgccgccgctggccagcagggcgtggtgcgccgcgatccgttcgccatgctg
ccgttctgcggctacaacatggctgattatttcgcgcactggctcaagctgggcgaccaa
ctggccaagagcggcgccacgctgccgaagatcttctgcgtcaactggttccgcaaggac
gaacagggccgtttcgtgtggccgggtttcggcgagaacatgcgcgtgctgaagtggatg
atcgaccggatcgagggccaggtccgcggcgacgagcacgtcttcggcgtgtcgccgcgc
tatgaggaactgcgctgggacgggctggacttctccgccgagcagttcgccaaggtgatc
tcgctggatgcgcaggcctggaagcaggagctggcgttgcacgccgagctgttcgcccag
ctggcgcatcatctgccgcaggcgctgccggaagccaaggcgcgcctggagggccgcctg
caaggctga

DBGET integrated database retrieval system