KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0212Help
Entry
RPSI07_mp0212     CDS       T01273                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RPSI07_mp0212 (ahpF)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RPSI07_mp0212 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 FAD_oxidored Glutaredoxin DAO HI0933_like FAD_binding_2 FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: CBJ34568
LinkDB All DBs
Position
mpPSI07:258724..260298
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVASIDDSEGSRDMMDLLRDVAGQSGMITLNEQRDDAE
RKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKLDDDTIEQIRGIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALFQDEVEARKIMAVPTLFLNGEV
FGQGRMGVEEILAKIDTGAAARDAEKLNAKAPYDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTLAIENFISVQETEGPKFAAALEQHVRQYGVDIMNAQRAVKLTPADEPG
GFSEVTLANGAVLKGRSIILSTGARWRNVNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRKLESLPNATILTNAQTTEITGN
GEKVNGLRYKNRTNGVEHDVALEGVFVQIGLVPNTEWLDGVVERNRFGEIIVDARGHTSV
AGVFAAGDSTTVPFKQIIIATGEGAKASLSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgatgtcaaggcccaactgaaagcctacctcgaacgccttgtgcagccc
atcgaactggtcgcctcgatcgatgacagcgaaggctcccgcgacatgatggacctgctg
cgcgacgtcgccgggcagtccggcatgatcacgctcaacgagcagcgcgacgacgccgag
cgcaagccgtcgttcctgatccgccgcaccggcaccgatgtcggtgtccgtttcgcggcc
atcccgacgggccacgagttcacctcgctcgtgctggcgctgctgcaagtgggcggctac
gcccccaagctcgatgacgacaccatcgaacagattcgtggtatcgagggcgatttccgc
ttcgagacctatatgtccctgacatgccagaactgcccggacgtggtccaggcgctgaac
gtcatgtcggtgatcaacccgcgcatccagcacgtcgccatcgacggcgcgctgttccag
gacgaagtggaagcgcgcaagatcatggccgtgccgaccctcttcctgaacggggaagtc
ttcggccagggccgcatgggcgtggaagagattctcgccaagatcgacaccggcgccgcc
gctcgcgacgccgagaagctcaacgcaaaggcaccgtacgacgtgctgatcgtcggcggc
ggcccggccggcgcggcggcggccgtgtatgcagcgcgcaagggcgtgcgcaccggcgtg
gtggccgagcgtttcggcggccaggtgctggacacactggccatcgagaacttcatctcc
gtgcaggagaccgaagggccgaagttcgctgccgcgctggagcagcacgtgcgccagtat
ggcgtcgacatcatgaacgcgcagcgcgccgtcaagctcacgccggccgacgagccgggc
ggcttctccgaagtgacgctcgccaacggtgcggtgctcaagggccgctcgatcatcctg
tcgaccggtgcgcgctggcgcaacgtcaacgtgccgggcgagcaggaataccgcaaccgc
ggcgtggcgtactgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggccgtg
atcggcggcggcaactccggcgtggaagccgcgatcgatctggcgggcatcgtcagccat
gtcacgctgctcgagttcggcgatcagctcaaggccgacgccgtgctggtgcgcaagctg
gagagcctgcccaacgcaaccatcctcaccaacgcacagaccaccgagatcactggtaac
ggcgaaaaggtcaacggcctgcgctacaagaaccgcaccaacggcgtcgagcacgacgtc
gcgctggaaggcgtgttcgtgcagatcggcctggtgcccaacactgagtggctcgacggc
gtggtggagcgcaaccgcttcggcgagatcatcgtcgatgcgcgcggccacaccagcgtg
gcgggcgtgttcgcggcgggcgactcgaccaccgtgccgttcaagcagatcatcatcgcc
acgggcgagggcgccaaggcctcactgtccgccttcgatcatctgatccgggtgccgctg
gccgaagccgcctga

DBGET integrated database retrieval system