KEGG   Ralstonia solanacearum CMR15: CMR15_10347Help
Entry
CMR15_10347       CDS       T02725                                 

Gene name
glpK
Definition
(GenBank) Glycerol kinase (ATP:glycerol 3-phosphotransferase)
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00561  Glycerolipid metabolism
rsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CMR15_10347 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsm04147]
    CMR15_10347 (glpK)
Enzymes [BR:rsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CMR15_10347 (glpK)
Exosome [BR:rsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMR15_10347 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-ProteinID: CBJ36557
UniProt: D8N532
LinkDB All DBs
Position
complement(370512..372008)
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPFDIWNSQLATCRA
ALEQARLGAADMAALGITNQRETTVVWERATGRPIFNAIVWQDRRTEAICERLRAEGLED
EVRKRTGLVIDPYFSGTKLRWILDHVDGARERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTLLWNIHTGQWDADLMRALDIHPSLLPEVHPSAHCFGQTDADWLGAPLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGERVVESRNGLISTAACQSGSRRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTSIGHIARAALESIAFQSTALLQAMTRDAVSAITELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRSEDEVARQWRASRTFHPVISRDEAQHRM
AQWEMAVAQVRLPTTHGH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacgtccagttcgcgtgccatcgtgttcaac
cgcgccggccagatcgtcgccagcgcccagcaggagtttccgcagcattttccgcagccc
ggctgggtcgagcacgatccgttcgacatctggaacagccagctcgccacctgccgcgcc
gcgctcgaacaggccaggctgggcgccgccgacatggccgcactcggcatcaccaaccag
cgcgagaccaccgtggtgtgggaacgcgccaccggccgccccatcttcaatgccatcgtc
tggcaggaccgccgcaccgaggcgatctgcgaacggctgcgcgccgagggcctggaggac
gaggtgcgcaagcgcaccgggctggtgattgatccgtatttctcgggcaccaagctgcgc
tggatcctcgaccacgtggacggcgcccgcgaacgcgccgcgcgcggcgagctcgccttc
ggcaccatcgacagctggctggtgtggcagctcacacgcggccgcctgcacgtgaccgac
gtgtccaacgcctcgcgcaccctgctgtggaacatccacaccggccagtgggatgccgac
ctgatgcgcgcgctcgacatccacccgagcctgctgccggaggtgcacccgtcggcccat
tgcttcggccagaccgatgccgactggctgggcgcgccgctcaccatcggcggcatcgcc
ggcgaccagcagtcggcgctgttcggccaggcctgcttcaagccgggcatggccaagaac
acctacggcaccggctgcttcatgctgctcaacaccggcgagcgtgtggttgaatcgcgc
aacgggctgatcagcacggcggcctgccagagcggcagccggcgcagttatgcgctggaa
ggcagcgtgttcgtcggcggcgcggtggtgcagtggctgcgtgacgggctgcgcgcgatc
cagcgctcggccgacgtggaggggctcgcggcctcggtgccggattcgggcggcgtggtg
ttcgtgccctcgttcaccggactgggggcgccgtactgggacccgaccgcgcagggcgcg
atcgtcgggctgtcgcgcggcacgagcatcggccatatcgcgcgggcggcgctggagtcg
atcgcgttccagagcaccgcgctgctgcaggcgatgacgcgcgacgcagtctcggccatc
acggagctgcgcgtggacggcggcgcctcggccaacaacctgctgctgcagttccaggcc
gacctgctcggcattccggtggtgcgcccggagatcatcgagaccacggcgctgggcgcg
gcctacctggccggcatcgccaccggcttctaccggagcgaggacgaggtcgcgcggcag
tggcgcgcctcgcgcacgttccacccggtcatcagccgcgacgaagcgcagcaccgcatg
gcgcaatgggagatggcggtggcgcaggtgcggctgccgaccacgcacggccactga

DBGET integrated database retrieval system