KEGG   Ralstonia solanacearum CMR15: CMR15_10349Help
Entry
CMR15_10349       CDS       T02725                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00564  Glycerophospholipid metabolism
rsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CMR15_10349 (glpD)
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CMR15_10349 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CBJ36559
UniProt: D8N534
LinkDB All DBs
Position
complement(372779..374356)
Genome map
AA seq 525 aa AA seqDB search
MHHTDASHLDCDLLVVGGGINGVGIARDAVGRGLSVVLCEKDDLAQHTSSASTKLIHGGL
RYLEYYEFSLVRKALLEREVLLRMAPHIMWPLRFVMPHDRSQRPAWMIRAGLFLYDHLAR
RRFLPGSEAVRLAQHPAGGPLKPGFARGFVYSDGWVDDARLVVLNARDAADRGAQILTRT
RCLNAERRADGWHASLAGPDGIRSVRAKAIVNAAGPWAAEFARAAHALPDTRGLRLIKGS
HIIVRRLFDHPFAYIFQNPDGRIVFAIPYQDDFTLIGTTDLEYTGPLDQVAIDAGEIDYL
CEMANRYFARQLTPADVVWNYSGVRPLLDDSAASASAITRDYLVECETGADGRAAPLINV
WGGKITTYRKLAEEALDKLAPHLPAAGAPSWTATAALPGGDLEAPGQLVGQYTFADFVTR
LQKRLPWLPSRLAKRYAHQYGTRVTTLLAGAARLDDLGAEVTPGLYEAEIRYLIEYEWAR
TAQDILWRRTKLGLYAAEADRGRLEAWLTRHPPTAEADPEALRAP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacaccgatgcgtcgcatctggactgtgatctgctggtggtcggaggcggcatc
aacggggtcggcattgcgcgcgacgccgtgggccgtggcctgtcggtggtcttgtgcgag
aaggacgacctcgcccagcacacctcttcggcatcgaccaagctgatccacggcgggctg
cgttatctcgaatattacgaattcagccttgtgcgcaaggcgctgctggagcgcgaggtg
ctgctgcgcatggcgccgcacatcatgtggccgctgcgctttgtgatgccgcatgaccgc
agccagcggccggcctggatgattcgcgcgggtctcttcttatatgaccacctggcgcgc
cggcgctttctgcccggctcggaggcggtccggctggcgcagcatccggcgggcgggccg
ctcaagcccggctttgcgcgcggcttcgtctattccgacgggtgggtcgacgatgcccgc
ctggtggtgctcaatgcccgcgatgccgccgaccgcggcgcgcagatcctcacccgcacc
cgctgcctgaacgcggagcgccgcgccgacggctggcatgcgtcgctggcggggccggac
ggcatccgctccgtgcgggcgaaggcgatcgtcaacgcggccggtccgtgggccgcggag
ttcgcccgggcggcgcacgcgctgccggacacgcgcggcctgcgcctcatcaagggcagc
cacatcatcgtgcggcggctgttcgaccatccgttcgcctatatcttccagaacccggac
gggcggatcgtctttgcgatcccgtaccaggatgacttcacgctgatcggcacgacggac
ctggagtacaccggcccgctggaccaggtcgccatcgacgccggcgagatcgactatctg
tgcgagatggccaaccgctatttcgcgcggcagctgacgcccgccgatgtggtgtggaac
tactcgggcgtacggccgctgctcgacgacagcgccgccagcgcgtcggccatcacgcgc
gactacctggtcgaatgcgagaccggggccgatgggcgtgcggcgccgctgatcaatgtc
tggggcggcaagatcaccacctaccgcaagctggccgaggaagcgctggacaagctggcg
ccgcacctgccggcggcgggtgcgccgtcgtggacggccacggccgccctgcccggcggc
gatctggaggcgcccggccaactggtcgggcagtacaccttcgccgattttgtgacccgc
ctgcaaaagcgtttgccatggctgccatccaggctggcgaagcgctatgcgcaccagtac
ggcacgcgcgtgaccacgctgctcgcgggcgcggcgcggctggacgacctgggcgcggag
gtcacgcccggcctgtacgaagccgagatccgctatctgatcgagtacgaatgggcccgc
acggcgcaggacatcctgtggcggcggaccaagctgggcctgtacgccgccgaggccgac
cgcggccgcctggaagcctggctgacgcggcacccgccgaccgccgaggccgatccggag
gcgctgcgcgcgccctga

DBGET integrated database retrieval system