KEGG   Ralstonia solanacearum CMR15: CMR15_10353Help
Entry
CMR15_10353       CDS       T02725                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
rsm  Ralstonia solanacearum CMR15
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rsm03012]
    CMR15_10353 (tufB)
   03029 Mitochondrial biogenesis [BR:rsm03029]
    CMR15_10353 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsm04147]
    CMR15_10353 (tufB)
Translation factors [BR:rsm03012]
 Eukaryotic Type
  Elongation factors
   CMR15_10353 (tufB)
 Prokaryotic Type
   CMR15_10353 (tufB)
Mitochondrial biogenesis [BR:rsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CMR15_10353 (tufB)
Exosome [BR:rsm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CMR15_10353 (tufB)
  Exosomal proteins of breast cancer cells
   CMR15_10353 (tufB)
  Exosomal proteins of colorectal cancer cells
   CMR15_10353 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBJ36562
UniProt: D8N537
LinkDB All DBs
Position
382653..383843
Genome map
AA seq 396 aa AA seqDB search
MAKEKFARTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgcgcggaccaagccgcacgtgaacgttgggacgatcggtcac
gttgaccacggcaagacgacgctgacggcagcaatcgcgacggtgctgtcgagcaagttc
ggtggcgaagcgaagaagtacgacgaaatcgacgcagcaccggaagaaaaggcacgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggccaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgccatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcccgccaggtcggcgtgccgtacatcatcgtcttcctgaacaagtgcgacatg
gtggacgacgctgagctgctggaactggtcgaaatggaagtgcgcgagctgctctccaag
tacgacttcccgggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgcactggacacc
tacatcccgacgccggagcgcgctgttgacggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggcatcaaggccacgcaaaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaggctggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagccgggttcg
atcaagccgcacacgcacttcactggcgaggtctacatcctgtcgaaggacgaaggtggt
cgtcacaccccgttcttcaacaactatcgcccgcagttctacttccgtacgaccgacgtg
accggctcgatcgagctgccgaaggacaaggagatggtcatgcccggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggcctgcgcttcgccatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgctaagatcatcgagtaa

DBGET integrated database retrieval system