KEGG   Ralstonia solanacearum CMR15: CMR15_10573Help
Entry
CMR15_10573       CDS       T02725                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase B, affects cell division
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00473  D-Alanine metabolism
rsm00550  Peptidoglycan biosynthesis
rsm01100  Metabolic pathways
rsm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CMR15_10573 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CMR15_10573 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CMR15_10573 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsm01011]
    CMR15_10573 (ddlB)
Enzymes [BR:rsm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CMR15_10573 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:rsm01011]
 Precursor biosynthesis
  Amino acid ligase
   CMR15_10573 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST GARS_A SEEK1 TTL
Motif
Other DBs
NCBI-ProteinID: CBJ36782
UniProt: D8N638
LinkDB All DBs
Position
611262..612257
Genome map
AA seq 331 aa AA seqDB search
MTTGPFVPHPTLDPKSLGKVGVILGGRSAEREISLLSGNGVLAALRSRGVDAHPFDPGTQ
PVAGLAAQGFHRVVISLHGRFGEDGTIQGLLEQFGIPYTGSGVLASALAMDKEATKRLWQ
THSLPTPDFVMLHAGADWQAVADRLGLPLIVKPAREGSSIGLTKVTSVAELPAAYEKAAR
LDRDVMAEQFIDGDELTCAVIGEGEHATALPLIRIVAPQANYDYQHKYFTDDTRYECPAP
IPADAAARVQALVVQAYRSLGCRGWGRADIMLRKHDGAPFLLEMNTSPGMTGHSLVPMAA
RAVGISYEDFVLQLAATASLELRASHDWKPE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccggtccgttcgtcccccatccgacgctcgatccgaagtccctcggcaaggtg
ggcgtgatcctcggcggccgctcggccgagcgcgagatctcgctgctgtcgggcaacggc
gtgttggcggcgctgcgctcgcgcggcgtcgacgcgcatccgttcgacccgggcacgcag
ccggtggccgggctcgccgcgcagggcttccaccgcgtggtgatctcgctgcacggccgc
ttcggcgaggacggcacgatccaggggctgctcgagcagttcggcattccctacaccggc
agcggcgtactcgcgtctgcgctggcgatggacaaggaagccaccaagcgcctgtggcag
acgcacagcctgccgacccccgatttcgtgatgctgcacgccggcgccgactggcaggcc
gttgccgaccgcctgggcctgccgctgatcgtcaagccggcgcgcgagggctcgtcgatc
ggcctgaccaaggtgaccagcgtggccgaactgcccgccgcctacgaaaaggccgcgcgc
ctggaccgcgacgtgatggccgaacagttcatcgacggcgacgagctgacctgcgccgtg
atcggcgaaggcgagcacgcgacggcgctgccgctgatccgtatcgtcgcgccgcaggcc
aactacgactaccagcacaagtacttcaccgacgacacgcgctacgagtgccccgcgccg
attcccgccgatgcggcggcgcgcgtgcaggcgctggtggtgcaggcgtatcgcagcctg
ggctgccgcggctggggccgcgccgacatcatgctgcgcaagcacgatggcgcgccgttc
ctgctcgagatgaacacttcgccgggcatgaccgggcattcgctggtgccgatggccgcg
cgcgcggtgggcatcagctatgaagatttcgtgctgcagctggcggcgaccgcgtcgctg
gagttgcgcgcgagccacgactggaaaccggaataa

DBGET integrated database retrieval system