KEGG   Ralstonia solanacearum CMR15: CMR15_11008Help
Entry
CMR15_11008       CDS       T02725                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rsm  Ralstonia solanacearum CMR15
Brite
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CMR15_11008 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBJ37214
UniProt: D8N8W0
LinkDB All DBs
Position
1064353..1064901
Genome map
AA seq 182 aa AA seqDB search
MKQLVIGLAAIGLMAGCASNAGTGASTGAPAAGTSALATLAPKSGSNVQGTIKLLQQGDN
RVAMAVDIGGLPPNGMFGFHVHEKGDCSSPDGMSAGGHFNPTGQPHGDPRSGPHHAGDIP
MLQSDASGKAVGSIVLNGVTLTPGATSVVGRAVVVHAGMDDYKTQPAGNSGVRVACGVIV
AN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgtgatcggacttgccgcgatcggcctgatggccggctgcgcttcgaat
gccggcaccggcgccagcaccggcgcacccgccgccggcacctcggctttggccacgctg
gcgcccaagagcggcagcaacgtgcaaggcaccatcaagctgctgcagcaaggcgacaac
cgggttgcgatggcggtcgacattggcggcctgccgcccaacggcatgttcggcttccat
gtgcacgagaagggcgactgctcctcgccggacggcatgagcgcgggcggtcacttcaac
ccgaccggccagccgcacggcgatccgcgctccggcccgcatcatgccggcgacatcccg
atgctgcagtccgacgccagcggcaaggccgtcggctcgatcgtcctgaacggcgtcacg
ctcacgcccggcgccaccagcgtggtcggccgcgcggtggtcgtccacgcgggcatggac
gactacaagacccagccggccggcaactccggcgtgcgcgtcgcttgcggcgtgatcgtg
gcgaactga

DBGET integrated database retrieval system