KEGG   Ralstonia solanacearum CMR15: CMR15_11292Help
Entry
CMR15_11292       CDS       T02725                                 

Gene name
dgkA
Definition
(GenBank) Diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00561  Glycerolipid metabolism
rsm00564  Glycerophospholipid metabolism
rsm01100  Metabolic pathways
rsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CMR15_11292 (dgkA)
   00564 Glycerophospholipid metabolism
    CMR15_11292 (dgkA)
Enzymes [BR:rsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CMR15_11292 (dgkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAGK_prokar
Motif
Other DBs
NCBI-ProteinID: CBJ37495
UniProt: D8NAG2
LinkDB All DBs
Position
complement(1353315..1353767)
Genome map
AA seq 150 aa AA seqDB search
MKPTTPPKRPAPPPAAGAYSPADNPHKGNRGLTRAWFALKHSISGIRFAIDEESAFRQEL
TLCAVLLPCAFIIPATVVERILMIGTLVLVLIVELLNSSVEAAVDRISLEQHGLSKRAKD
FGSAAVMLALLLCAGTWVAIAWPWVASLLR
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaccacgccgccgaaacgccctgctccgccgcccgcagcgggcgcctactcg
cccgccgacaatccgcacaaaggcaaccggggcctcacgcgggcatggttcgcgctcaag
cattccatcagcggcatccgcttcgccatcgacgaggagagcgcgttccgccaagagctg
acgctgtgcgccgtcctgctgccatgcgccttcatcatcccggccacggtggtggagcgc
atcctgatgatcggcacgctggtgctggtgctgatcgtcgagctgctcaattcgagcgtg
gaggcggcagtggaccgcatctcgctggagcagcacgggctgtccaagcgcgccaaggac
ttcggcagcgcggcggtcatgctagccctgctgctgtgcgcgggcacctgggtggcgatc
gcgtggccgtgggtggcgtcgctgctgcgctga

DBGET integrated database retrieval system