KEGG   Ralstonia solanacearum CMR15: CMR15_20316Help
Entry
CMR15_20316       CDS       T02725                                 

Definition
(GenBank) Lipase, class 3
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00561  Glycerolipid metabolism
rsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CMR15_20316
Enzymes [BR:rsm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     CMR15_20316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_3 Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: CBJ38359
UniProt: D8ND21
LinkDB All DBs
Position
2240841..2241377
Genome map
AA seq 178 aa AA seqDB search
MVQPQVGAESSAARAIIEGDAVAFPGTNNVACWLANLDADVVQVEGLGGLHHGFWHALSS
IRPQLLALPAPAVAVGHSEGAALAILFAAVLCLAGQPPRAVYGFEPPRVSTDGTLATLLA
THGVQVNLYRNGQDVVPMVPRLLRAWQHPAPLIEIGHAAWPMPNVEDHKLARVIQALA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggtccagccccaggtaggcgccgagagcagcgccgctcgggcgatcatcgagggggac
gcggtcgcgttccccggcaccaacaacgtcgcgtgctggctggccaacctcgatgccgat
gtcgttcaggtggagggcctgggcggcctgcatcacgggttctggcatgcgctgtcatcg
atccggccccaactgctggcgctaccggcgccggccgtcgccgtcgggcacagcgagggt
gccgcgctggccatcctgtttgcggccgtgctgtgcctggcaggtcagccaccgcgcgcc
gtgtacgggttcgagcctccgcgtgtgagcaccgacgggacgctggcgacgctgctggct
acgcacggcgtgcaggtcaacctgtaccgcaacgggcaggacgtggtgccgatggtgccg
cgcctgctgcgcgcctggcagcacccggcgccgctgattgagattggacacgcggcgtgg
ccgatgcccaacgtcgaggaccacaagctggcgcgcgtgattcaggcgctggcttga

DBGET integrated database retrieval system