KEGG   Ralstonia solanacearum CMR15: CMR15_30079Help
Entry
CMR15_30079       CDS       T02725                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CMR15_30079 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsm02000]
    CMR15_30079 (gst)
Enzymes [BR:rsm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CMR15_30079 (gst)
Transporters [BR:rsm02000]
 Other Transporters
  Pores ion channels [TC:1]
   CMR15_30079 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 Minor_tail_Z GST_N_5
Motif
Other DBs
NCBI-ProteinID: CBJ38831
UniProt: D8N686
LinkDB All DBs
Position
complement(2742995..2743615)
Genome map
AA seq 206 aa AA seqDB search
MKLYYFPGACSLSPHIVAREAGIALQLVKVDIRAKRTEHGEDFHRINPKGAVPVLELDSG
ERLTEGPAIAQYLADLKPESGLAPANGTMARYRLQEWLGWINSELHKSYSPLFNPSTPET
VRQERKDALHRQYALAEQHLAAHPWLLGERFSAADAYLFTVTNWAGHVGLDLSAFTALSA
FQQRVASRPAVLAALEAEGLLSEAGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactttcccggagcctgttcactctcgccgcacatcgtggcgcgcgag
gcgggcatcgccctgcagctcgtcaaggtcgacatccgggccaagcgcacggaacacggt
gaagacttccaccggatcaaccccaagggtgccgtgcccgtcctcgaactggacagcggc
gagcggctgaccgaaggcccggcgattgcgcagtaccttgccgacctcaagcccgaaagc
ggtctggcccccgccaacggcaccatggcgcgctatcgcttgcaggagtggctgggctgg
atcaactcggaactgcacaagagctactcgccgctgttcaatccgtccacgcccgagacg
gtccggcaggagcgcaaggatgccctgcaccggcagtacgcgctggcggagcagcacctg
gcggcccatccctggctgctgggcgaacgtttctcggcggcagacgcctatctgttcacg
gtcaccaactgggccgggcatgtgggcctcgacctgtcggccttcacggcgctgtccgca
ttccagcagcgcgtcgcgtcgcggccggccgtgctggcggcgctggaggccgaggggctg
ttgagcgaggcgggggcgtaa

DBGET integrated database retrieval system