KEGG   Ralstonia solanacearum CMR15: CMR15_30845Help
Entry
CMR15_30845       CDS       T02725                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00970  Aminoacyl-tRNA biosynthesis
rsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CMR15_30845 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsm03029]
    CMR15_30845 (gatA)
Enzymes [BR:rsm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CMR15_30845 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CMR15_30845 (gatA)
Mitochondrial biogenesis [BR:rsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CMR15_30845 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Unstab_antitox
Motif
Other DBs
NCBI-ProteinID: CBJ39592
UniProt: D8NAC3
LinkDB All DBs
Position
3523088..3524575
Genome map
AA seq 495 aa AA seqDB search
MTASTLKTLSAQLAAKEVSAVELARHYLARIEARADLNAFIHVDPEATLAQAQAADARLA
AGDAGPLAGIPIAHKDVFVTRGWRATAGSKMLDSYVSPFDATVVERLAAAGMVTLGKTNM
DEFAMGSSNENSHFGPVKNPWDVARVPGGSSGGSAAAVAADLAPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMARTAEDCALLLSAMAGFDARDSTSLEPG
RGGDAEDFGRLLGRPLEGADAARPLAGLRIGLPQEYFGAGLADDVRAAVRAALAELETLG
ATLVDISLPKTELSIPTYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLADMYRKTRAEGF
GWEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQNAFGQCDVIMGPVAPTVAWKL
GEKTDDPLQMYLADIFTLSTSLAGLPGMSVPAGFGANGLPVGLQIIGNYFEEARMLQIAH
AFQQATDWHTRQPAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccacgctcaaaaccctgtccgcccaactcgccgccaaggaagtgtcggcg
gtggaactggcgcgccactacctggcgcgcatcgaggcgcgggccgacctgaacgccttc
atccatgtcgaccccgaggccacgctggcgcaggcgcaggccgccgacgcgcgcctggcc
gccggcgacgcggggccgctcgccggcatcccgatcgcgcacaaggacgtgttcgtcacg
cgcggctggcgcgccacggccggctccaagatgctcgacagctatgtgagcccgttcgac
gccaccgtggtcgagcgcctggccgccgccggcatggtgacgctgggcaagaccaacatg
gacgagttcgcgatgggctcgtccaacgagaactcgcatttcggcccggtcaagaatccg
tgggatgtcgcgcgcgtgccgggcggctcgtccggcggctcggccgcggccgtggcggcg
gacctggcgccggccgcgaccggcaccgacaccggcggctcgatccgccagcctgcatcg
ttctcgggcatcaccggcatcaaaccgacgtatggccgggtgtcgcgctacggcatgatc
gcctttgcctcgtcgctggaccagggcggcccgatggcacgcacggccgaggactgcgcg
ctgctgctgtcggccatggccggcttcgacgcgcgcgattccaccagcctcgagccgggc
cgcggcggcgacgcggaagacttcggccgcctcctgggccgcccgctggaaggcgccgac
gccgcccgcccgctggccggcctgcgcatcggcctgccgcaggaatacttcggcgcgggg
ctggccgacgacgtgcgcgccgccgtgcgggccgcgctggccgagctggagacgctgggc
gccacgctggtcgacatcagcctgcccaagaccgaactgtcgatcccgacctactacgtg
atcgccccggccgaggcctcgtccaacctgtcgcgcttcgacggcgtgcgctacggccac
cgcgcggcggagtaccgcgacctggccgacatgtaccgcaagacccgcgccgaaggcttc
ggctgggaggtcaagcgccgcatcctggtcggcacctatgtgctgtcgcacggctactac
gacgcctactacctgcaggcgcagaagatccgccgcatcatcgcgcaggatttccagaac
gcgttcgggcaatgcgatgtgatcatggggccggtggcgccgacggtggcgtggaagctc
ggcgagaagaccgacgatccgctgcagatgtacctggccgacatcttcacgctgtcgacc
agcctggccggcctgccgggcatgagcgtgccggccggcttcggcgcaaacggtctcccg
gttggcttgcagatcattggcaactattttgaagaggcacgcatgctgcagatcgcgcat
gcgttccagcaggcgaccgactggcacacgcgccagccggcggcctga

DBGET integrated database retrieval system