KEGG   Ralstonia solanacearum CMR15: CMR15_mp10219Help
Entry
CMR15_mp10219     CDS       T02725                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rsm  Ralstonia solanacearum CMR15
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CMR15_mp10219 (ahpF)
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CMR15_mp10219 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin HI0933_like FAD_oxidored Thi4 FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 K_oxygenase FAD_binding_2 FMO-like
Motif
Other DBs
NCBI-ProteinID: CBJ39873
UniProt: D8NG49
LinkDB All DBs
Position
CMR15_mp:259144..260718
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVASIDDSEGSRDMMDLLRDVAAQSGMIALTEQRDDAE
RKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKLDDDVIEQIRNIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALFQDEVEARKIMAVPTLFLNGEV
FSQGRMGVEEILAKIDTGAATRDAEKLNARAPYDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTMSIENFISVPETEGPKFAAALEQHVRQYNVDIMNVQRAVKLTPADEPG
GLAEVTLANGAVLKGRSIIVSTGARWRNVNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRKLESLPNATILTNAQTTEITGN
GEKVNGLRYRHRTNGAEHDVALEGVFVQIGLVPNTEWLDGVVERNRFGEIIVDARGHTSV
PGVFAAGDSTTVPFKQIIIATGEGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgatgtcaaggcccaactgaaagcctacctcgaacgccttgtgcagccc
atcgaactggtcgcctcgatcgatgacagcgaaggctcccgcgacatgatggacctgctg
cgtgatgtcgccgcgcagtccggcatgatcgcgctcaccgaacagcgcgacgacgccgag
cgcaagccgtcgttcctgatccgccgcactggcaccgatgtcggtgtccgtttcgcggcc
atcccgaccggccacgagttcacctcgctcgtgctcgcgctgctgcaggtgggcggctac
gcccccaagctcgatgacgatgtcatcgaacagattcgcaacatcgaaggcgatttccgc
ttcgagacctatatgtccctgacgtgccagaactgcccggacgtggtccaggcgctgaac
gtcatgtcggtgatcaacccgcgcatccagcacgtcgccatcgacggcgcgctgttccag
gacgaagtggaagcgcgcaagatcatggccgtgccgaccctcttcctgaacggggaagtc
ttcagccagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgcc
acccgcgacgccgagaagctcaacgcccgcgcaccgtacgacgtgctgatcgtcggcggc
gggccggccggcgcggcggcagccgtgtatgccgcgcgcaagggcgtgcgcaccggcgtg
gtggccgagcgcttcggcggccaggtgctcgacaccatgagcatcgagaacttcatctcc
gtgccggagaccgaagggccgaagttcgccgccgcgctggagcagcacgtgcgccagtac
aacgtcgacatcatgaacgtgcagcgcgccgtcaagctcacgccggccgacgagccgggc
ggcctcgctgaggtcacgctggccaacggcgcggtgctcaagggccgctcgatcatcgtg
tcgaccggcgcgcgctggcgcaacgtcaacgtgccgggcgagcaggaataccgcaaccgc
ggcgtggcgtactgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggccgtg
atcggcggcggcaactccggcgtggaagccgcgatcgacctggcgggcatcgtcagccat
gtcacgctgctcgagttcggcgaccagctcaaggccgatgccgtgctggtgcgcaagctg
gaaagcctgcccaacgcgaccatcctcaccaacgcccagaccaccgagatcaccggtaac
ggcgaaaaggtcaacggcctgcgctacaggcaccgcaccaacggcgccgagcacgacgtc
gcgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcgacggc
gtggtggagcgcaaccgcttcggcgagatcatcgtcgatgcgcgcggccacaccagcgtg
ccgggcgtgttcgcggcgggcgactcgaccacggtgccgttcaagcagatcatcatcgcc
acgggcgagggcgccaaggccgcactgtccgccttcgatcacctgatccgggtgccgctg
gctgaagccgcctga

DBGET integrated database retrieval system