KEGG   Ralstonia solanacearum Po82: RSPO_c01037
Entry
RSPO_c01037       CDS       T02005                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn03030  DNA replication
rsn03430  Mismatch repair
rsn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    RSPO_c01037 (holC)
   03430 Mismatch repair
    RSPO_c01037 (holC)
   03440 Homologous recombination
    RSPO_c01037 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rsn03032]
    RSPO_c01037 (holC)
   03400 DNA repair and recombination proteins [BR:rsn03400]
    RSPO_c01037 (holC)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RSPO_c01037 (holC)
DNA replication proteins [BR:rsn03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RSPO_c01037 (holC)
DNA repair and recombination proteins [BR:rsn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     RSPO_c01037 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AEG68338
UniProt: F6FZQ2
LinkDB
Position
1079907..1080335
AA seq 142 aa
MTRVDFHSNVPGKLAYACRLVRKAYGAGQKVIVVGNRAALEAFDAQLWTFSQLDFLPHCG
LRHPLAAQTPILLADIAEPLDDAPHHDILINLSDATPPLFARFARLIEIVGDDEADRTAA
RDRFRFYRDRGYPIQHHDVGRA
NT seq 429 nt   +upstreamnt  +downstreamnt
atgacccgtgtcgatttccacagcaacgtgcccggcaagctggcctatgcctgccggctg
gtgcgcaaggcctacggcgcgggccagaaggtgatcgtggtggggaaccgcgcagcgctg
gaggccttcgacgcccagttgtggaccttcagccagctcgacttcctgccgcactgcggg
ctgcggcatccgcttgccgcacagacgccgatcctgctggccgacatcgccgagccgctg
gacgacgcgccccatcacgatattctcatcaacctgtcggatgccacgccgcccctgttc
gcgcggtttgcacgcctgatcgaaatcgtcggcgacgacgaggccgatcgcaccgccgcc
cgcgaccgcttccgcttctaccgcgaccgtggctatccgattcaacatcacgacgtgggg
cgcgcatga

DBGET integrated database retrieval system