KEGG   Ralstonia solanacearum Po82: RSPO_c01312Help
Entry
RSPO_c01312       CDS       T02005                                 

Gene name
maeB1
Definition
(GenBank) nadp-dependent malic enzyme protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00620  Pyruvate metabolism
rsn01100  Metabolic pathways
rsn01120  Microbial metabolism in diverse environments
rsn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSPO_c01312 (maeB1)
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     RSPO_c01312 (maeB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH ELFV_dehydrog Amidase_2
Motif
Other DBs
NCBI-ProteinID: AEG68613
UniProt: F6G031
LinkDB All DBs
Position
1387865..1390186
Genome map
AA seq 773 aa AA seqDB search
MNDKLHDASPDTLDKGAEAELRRAALEYHRSPTRGKIEVRSTKTLINQRDLSLAYSPGVA
YACTEIERDPSLAAEYTSRANLVGVITNGTAVLGLGDIGPLAGKPVMEGKGCLFKKFAGV
DVFDIELAERDPDKLVDIIASLEPTLGGINLEDIKAPECFYIEQKLRERLNIPVFHDDQH
GTAIISSAALLNGLKVVGKQIGEVKVAVSGAGAAAIACLDLMVSLGVKRENVFVVDSKGV
IYAGRDAKMEPNKARYAQDTAARTLADIVRDADVFLGCSAAGVLTADMVKTMGPKPIILA
LANPEPEIRPEVAKAARPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEAMKM
ACVKAIAELAEAETNDAVAQAYAGQELNFGPDYIIPKPFDSRLIEKIAPAVAKAAMESGV
ATRPIADLDAYRHQLNDFVYHTGLTMRPVFSAAKAAPKRVVYAEGEEERVLRAVQTVIDE
GLAKPILIGRPHVIEMRIQKAGLRLKPGVDFELVNPEDDPRFHQYHTAYHELMGRNGVTP
DMAKSALRRSNTLIGALLVRLGDADAMLCGTVGRFDAHLEHVRDVIGLAPNARVFAAMNG
LMLEKHTLFIADTFVNEDPTAEELAAITELAAEEVRRFGLEPKVAMLSHSMFGSSKSKSA
RKMRAAYDLLKAQAPDLQVEGEIQGDAALVEDIRHHFLPKSAFAGSANLLVMPTLDAANI
AFNLLKITGGHGVTVGPILLGAAKPVHILNPAATSRRIVNMTALAVADVSATR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaagcttcacgacgcctcgcccgatacgctcgacaagggtgccgaggccgaa
ctgcgccgcgccgcgctcgaataccaccgctcgccgacgcgaggcaagatcgaggtccgc
tcgaccaagacgctgatcaatcagcgcgacctgtcgctggcgtattcgccgggtgtggcc
tatgcgtgtaccgagatcgagcgcgatccgtcgctggcggccgagtacacctcgcgcgcc
aacctggtcggcgtgatcaccaacggcaccgccgtgctgggcctgggcgacatcggcccg
ctggccggcaagccggtgatggaaggcaagggctgcctgttcaagaagttcgccggcgta
gacgtgttcgacatcgaactggccgagcgcgatccggacaagctggtcgacatcatcgcg
tcgctggagccgacgctgggcggcatcaacctcgaggacatcaaggcgccggagtgcttc
tacatcgagcagaagctgcgcgagcgcctgaacattcccgtcttccacgacgaccagcac
ggcacggcgatcatctcgtcggccgcgctgctcaacggcctgaaggtggtcggcaagcag
atcggcgaggtcaaggtggcggtgtcgggcgcgggcgcggcggccatcgcctgcctggac
ctgatggtgagcctgggcgtcaagcgcgagaacgtgttcgtggtcgactccaagggcgtc
atctacgccggccgcgacgccaagatggagccgaacaaggcccgctatgcgcaggacacc
gcggcccgcacgctggccgacatcgtgcgcgacgcggatgtgttcctgggctgctcggcc
gccggcgtgctgactgccgacatggtcaagaccatggggccgaagccgatcatcctggcg
ctggccaaccccgagccggagatccgcccggaagtggccaaggccgcgcgtccggactgc
atcatcgcgacgggccgttcggactatccgaaccaggtcaacaacgtgctgtgcttcccg
tacatcttccgcggcgcgctcgattgcggcgccaccaagatcacggaagccatgaagatg
gcctgcgtgaaggccatcgccgagctggccgaagccgagaccaacgacgccgtggcccag
gcctacgccggccaggagctgaacttcggtccggactacatcattccgaagccgttcgat
tcgcgcctgatcgagaagatcgcgccggcggtggccaaggcagcgatggaatccggcgtg
gcgacgcgcccgatcgccgatctggacgcctaccgtcaccagctcaacgatttcgtctac
cacaccggcctgaccatgcgcccggtgttctccgccgccaaggccgcgcccaagcgcgtg
gtctacgccgagggtgaagaggagcgcgtgctgcgcgcggtgcagacggtgatcgacgaa
ggcctggccaagccgatcctgatcggccgcccgcacgtgatcgagatgcgcatccagaag
gccggcctgcggctgaagccgggcgtggatttcgagctggtgaacccggaagacgatccg
cgcttccaccagtaccacaccgcctaccacgagctgatgggccgcaacggcgtgacgccc
gacatggcgaaatccgcgctgcgccgctccaacacgctgatcggcgcgctgctggtgcgc
ctgggcgatgccgacgcgatgctgtgcggcacggtgggccgcttcgacgcgcacctcgag
catgtgcgcgacgtgatcggcctggcgcccaatgcccgcgtgttcgccgccatgaacggc
ctgatgctggagaagcacacgctgttcatcgccgataccttcgtcaacgaagacccgacg
gccgaagagctggccgcgatcaccgagctggctgctgaagaagtgcgccgcttcggcctg
gagccgaaggtggcgatgctgtcgcactcgatgttcggttcgtccaagagcaagtcggcg
cgcaagatgcgcgcggcgtacgatctgctgaaggcgcaggcgccggacctgcaggtggaa
ggcgagatccagggagatgccgcgctggtcgaggacatccgccaccacttcctgcccaag
agcgcgtttgccggcagcgccaacctgctggtgatgccgacgctggatgcggccaacatc
gccttcaatctgctcaagatcacgggcgggcatggcgtgacggtgggcccgatcctgctg
ggcgcggccaagccggtgcacatcctcaacccggcggccacgtcgcggcgcatcgtcaac
atgaccgcactggcggtggcggacgtgtcggcgacacgctga

DBGET integrated database retrieval system