KEGG   Ralstonia solanacearum Po82: RSPO_c02549Help
Entry
RSPO_c02549       CDS       T02005                                 

Definition
(GenBank) glutathione s-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RSPO_c02549
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsn02000]
    RSPO_c02549
Enzymes [BR:rsn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RSPO_c02549
Transporters [BR:rsn02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSPO_c02549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AEG69843
UniProt: F6G3L0
LinkDB All DBs
Position
complement(2668939..2669661)
Genome map
AA seq 240 aa AA seqDB search
MPRTGGLDYHALRAAIPADGSGGRAQLSNHSENTMKLYYFPGACSLSPHIVVREAGIDLQ
LVKVDLKAKRTEHGEDFHGINPKGAVPVLELDNGERLTEGPAIVQYLADLKPASGLAPAN
GTMARYRLQEWLGCINSELHKGYSPLFNPSTPETVRQERKDALRRHYALVEQHLATHPWL
VGEHFTAADAYLFTVTNWAGHVGLDLSAFTALAAFQQRVAARPAVLAALEAEGLLAEAGA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcggaccggcgggctcgactaccatgcactgcgcgcggcgatcccggcagacggt
tccggaggccgcgcgcagttgtccaaccactcggaaaacacgatgaagctctattacttt
cccggagcctgttcactctcgccgcacattgtggtgcgcgaggcgggcatcgatctgcaa
ctcgtcaaggtcgacctcaaggccaagcgcacggaacacggtgaagacttccacgggatc
aaccccaagggtgcggtgccggtcctcgaactggacaacggcgagcgcctgacggaaggc
ccggcgatcgtgcagtacctcgcagacctgaagccggcaagcggcctggcacccgccaac
ggcacgatggcacgctatcgcttgcaggaatggctgggctgcatcaactcggagctgcac
aaggggtactcgccgctcttcaatccgtccacgcccgagacggtccggcaggagcgcaag
gatgccctgcgcaggcactacgcgctggtggagcagcacctggcaacccatccctggctg
gtgggcgaacacttcacggcggccgacgcttatctgttcacggtcaccaactgggcgggg
cacgtgggcctcgatctgtcggcgttcacggcgctggcagcgttccagcagcgcgttgcg
gcacggccggcggtgctggctgcgctggaggcggaggggttgctggccgaggcgggggcg
taa

DBGET integrated database retrieval system