KEGG   Ralstonia solanacearum Po82: RSPO_c03014Help
Entry
RSPO_c03014       CDS       T02005                                 

Definition
(GenBank) ferredoxin protein
Organism
rsn  Ralstonia solanacearum Po82
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_10 Fer4_4 Fer4_21 Fer4_17 GF_recep_IV Fer4_6
Motif
Other DBs
NCBI-ProteinID: AEG70306
UniProt: F6G4B0
LinkDB All DBs
Position
complement(3140597..3140845)
Genome map
AA seq 82 aa AA seqDB search
MALMITDECINCDVCEPECPNGAISMGPEIYVIDPGKCTECVGHFDAPQCQQVCPVECIP
KDPAHAETHEQLMQKYVKLTAA
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcatgattaccgatgagtgcatcaattgcgacgtctgcgagcccgagtgcccc
aacggcgcgatttcgatgggcccggaaatctacgtgatcgacccgggcaagtgcaccgag
tgcgtcggccacttcgacgcgccgcaatgtcagcaggtctgtccggtcgagtgcattccc
aaggacccggcccacgccgaaacccacgagcagttgatgcagaagtacgtcaagctgacc
gcagcctag

DBGET integrated database retrieval system