KEGG   Ralstonia solanacearum Po82: RSPO_m00238Help
Entry
RSPO_m00238       CDS       T02005                                 

Gene name
treS
Definition
(GenBank) trehalose synthase, maltose alpha-d-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00500  Starch and sucrose metabolism
rsn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSPO_m00238 (treS)
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RSPO_m00238 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RSPO_m00238 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AEG70879
UniProt: F6G7E3
LinkDB All DBs
Position
megaplasmid:complement(263937..267458)
Genome map
AA seq 1173 aa AA seqDB search
MTRNPTVLLVDDALWYKDAVIYQLHVKSFCDSDNDGVGDFPGLISKLDYIAELGVDAVWL
LPFYPSPRRDDGYDIAEYRGVHPDYGTMADARRFIAEAHARGLRVITELVINHTSDQHPW
FQRARRAKAGSALRDFYVWSDHDKKYAGTRIIFIDTEPSNWTWDPVANAYYWHRFYSHQP
DLNFDNPRVLKAVLGVMKFWLNLGVDGLRLDAVPYLVEREGTANENLPETHAVLRKIRAA
MDTEFKNRLLLAEANQWPEDTQEYFGDGDECHMAFHFPLMPRMYMAIAREDRFPITDIMR
QTPEVPPTCQWAIFLRNHDELTLEMVTDSERDYLWEVYASDRRARLNLGIRRRLAPLLER
DRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADP
EQLVLPAIMGSLYGYESVNVEAQTRDAHSLLNWTRRLLATRKRHRVFGRGSIRFLQPANR
KVLAYIRALDGQDRDNPPILCVANLSRASQAVELDLSSYAQRVPVELIGGTAFPPIGQLP
YLLTLPAYAFYWLELRENEPGPSWAQPAAEQLPEFTTLVLRAGLDALADTRQREAHRQLI
EREILPAYLPMRRWFAAKDSVLRGARFAWGAEVPVDASSTNRPLAGATRPEVFINEIAVT
LGDADGTERTERYLLPLSIAWESATLPALPIQLALARVRRGRHVGYLTDAFTTETFTRAL
LATLVRGGTLEANDGKVRFEPEPHLAEPAASATSTKAAEVPAAADSATVRPAPLPLAPDA
AVQWLAAEQSNSSLVIGESVIVKLFRRVAAGVHPEMEMSRHLTRIGYANTAALIGEIAHE
SAGGERSTLAVVQSFVPNQGDAWTWALDYLRRTIDELAVLTEAVSAGDGEVAPTAVSEAR
TDTDEALAGYLAFIGAIGTRLGELHVALAAPSDDPAFGTGIANADDAAFWTARVREQLTR
ALGHLAAWQAANGPNADVDWLLSQRDALLEAARERALGGLGAMLERIHGDFHLGRVLVAQ
GDAFLIDFEGEPARPVEERRRKTSPLRDVAGLVRSLDYVVCAMRQGPEHVAGPAQERRDR
LLERFRNASTERFLDTYAAAIQEPAPEDGACVLDMDLLDLFLLEKAAYEVNYEAANRPAW
LPIPLAGLAHVARRLLHADVPPPVALDPLGGPP
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaacccgaccgtgctgctggtggacgatgcactctggtacaaggacgcggtc
atctatcaattgcacgtcaagtcgttctgcgattcggacaacgacggcgtgggggatttc
cccggcctgatctccaagctcgactacatcgccgagctgggcgtggacgcggtctggctg
ctgccgttctacccgtcgccgcgccgcgacgacggctacgacatcgccgaataccgcggc
gtgcatccggactacggcaccatggccgatgcgcgccgcttcattgccgaggcgcatgcg
cgcggcctgcgcgtgatcaccgagctggtcatcaaccacacctcggaccagcacccgtgg
ttccagcgcgcgcgccgcgccaaggcgggctcggcgctgcgcgacttctacgtgtggtcc
gaccacgacaagaaatacgccggcacgcgcatcatcttcatcgacaccgagccctccaac
tggacgtgggacccggtggccaacgcctactactggcaccgcttctattcgcaccagccc
gacctgaatttcgacaacccgcgcgtgctcaaggccgtgctgggcgtgatgaaattctgg
ctgaacctgggcgtggacggactgcggctggatgcggtgccctacctggtggagcgcgag
ggcacggccaacgagaacctgcccgagacgcacgccgtgctgcgcaagatccgcgcggcg
atggacacggagttcaagaaccgcctgctgctggccgaggccaaccagtggccggaagac
acgcaggaatacttcggcgacggcgacgaatgccacatggccttccacttcccgctgatg
ccgcgcatgtacatggcgatcgcgcgggaggaccgctttccgatcaccgacatcatgcgg
cagacgccggaagtgccgcccacctgccagtgggccatcttcctgcgcaaccacgacgag
ctgacgctggagatggtgaccgactcggagcgcgactacctgtgggaggtctacgccagc
gaccgccgcgcgcggctgaacctcggcatccgccggcgcctggcgccgctgctggagcgc
gaccgccgccgggtcgagctgatgaacagcctgctcttctcgatgcccggcacgccggtg
atgtactacggcgacgagatcggcatgggcgacaacatccacctgggcgaccgcgacggc
gtgcgcacaccgatgcagtggtcgcccgaccgcaacggcggcttctcgcgcgccgatccg
gagcaactggtgctgccggccatcatgggctcgctgtacggctacgaatcggtcaacgtg
gaggcgcagacgcgcgatgcgcattcgctgctgaactggacgcgccggctgctggccacg
cgcaagcgccaccgcgtgttcgggcgcggcagcatccggttcctgcagccggccaaccgc
aaggtgctggcctacatccgcgcgctggacggccaagatcgcgacaacccgccgatcctg
tgcgtggcgaacctgtcgcgggcctcgcaggcggtggagctggacctgtccagctacgcg
cagcgcgtgccggtggagctgatcggcggcacggcgtttccgcccatcggccagttgcct
tacctgctgacgctgccggcctacgcgttctactggctggagctgcgcgagaacgagccc
ggcccgtcgtgggcgcagccggccgcggagcagttgcccgagttcaccacgctggtcttg
cgcgcggggctcgacgcgctggccgacacgcgccagcgcgaggcgcaccgccagctgatc
gagcgcgagatcctgccggcctacctgcccatgcgccgctggttcgccgccaaggacagc
gtactgcgtggcgcgcgcttcgcctggggcgcggaggtgccggtggatgcgagttccacc
aaccggccgttggcgggtgcgacccggcccgaggtgttcatcaacgagatcgccgtcacg
ctgggcgatgcggacggcaccgagcgcaccgagcgctacctgctgccgctgtcgatcgcg
tgggagagcgccacgctgcccgcactgccgatccagctggcgctggcgcgcgtgcgccgc
ggccgccatgtcggctacctgaccgacgccttcactaccgagaccttcacccgtgcactg
ctggccaccctggtacgcggcggcacgctggaggccaacgacggcaaggtgcgcttcgag
cccgagccgcacctggccgaaccggccgcatcggccacctcgaccaaagcggccgaggtg
ccggcggccgccgactccgcaacggtgcgcccggcgcccctgccgctggcgcccgacgcg
gcggtgcagtggctggcggcggagcagtccaacagctcgctggtgatcggcgaatcggtc
atcgtcaagctgttccgccgggtggcggcgggcgtgcatccggaaatggagatgtcgcgc
cacctgacgcgcatcggctatgccaacacggccgcgctgatcggcgagatcgcgcacgag
agcgcgggcggcgagcgcagcacgctggccgtggtgcagagcttcgtgcccaaccagggc
gatgcgtggacctgggcgctcgactacctgcgccgcaccatcgatgagctggcggtgctg
acggaggcggtctcggccggcgacggcgaggtggcccccaccgccgtctcggaagcgcgc
accgataccgatgaagcgctggcgggctacctggccttcatcggcgccatcggcacgcgg
ctgggcgagctgcacgtcgcgctggccgcgccgtcggacgatcccgccttcggcaccggc
atcgcaaacgccgacgacgcggccttctggaccgcgcgcgtgcgcgagcagctcacccgc
gcgctcggccacctggcggcctggcaggcggccaacgggccgaacgccgatgtcgactgg
ctgctgtcgcagcgcgatgccctgctggaagccgcccgcgaacgcgcgctgggcgggctg
ggcgccatgctcgaacgcatccacggcgacttccacctcggacgggtgctggtggcgcag
ggcgacgccttcctgatcgacttcgaaggcgagccggcgcggccggtggaagagcgccgg
cgcaagaccagcccgctgcgcgacgtggccgggctggtgcgctcgctcgactacgtggtg
tgcgccatgcggcaaggccccgagcatgtggccggcccggcgcaggagcggcgcgaccgc
ttgctcgaacgcttccgcaatgcgtccaccgagcgcttcctggacacctatgcggcggcc
atccaggagccggcaccggaggacggcgcctgcgtgctcgatatggacctgctcgacctg
ttcctgctggagaaggcggcctacgaggtcaactacgaagccgccaaccggccggcctgg
ctgccgatcccgctggcgggcctcgcgcacgtggcgcgccggctgctgcacgcggacgtg
ccgccgccggtggcgctggatccgctcggaggcccgccatga

DBGET integrated database retrieval system