KEGG   Ralstonia solanacearum Po82: RSPO_m00245Help
Entry
RSPO_m00245       CDS       T02005                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, f52a subunit, fad/nad(p)-binding protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSPO_m00245 (ahpF)
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RSPO_m00245 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_2 FAD_binding_3 Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AEG70886
UniProt: F6G7F1
LinkDB All DBs
Position
megaplasmid:277841..279415
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKSYLERLVQPIELVASIDDSEGSRDMMDLLRDVAGQSSLIALNEQRDDAE
RKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKLDDDTIEQIRNLDGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGGLFQDEVEARKIMAVPTLFMNGEV
FSQGRMGVEEILAKIDTGAAERDAEKLNARAPYDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTLAIENFVSVQETEGPKFAAALEQHVRQYGVDIMNAQRAVKLVPADEPG
GLSEVTLANGAVLKGRSIILSTGARWRNVNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRKLESLPNATILTNAQTTEITGN
GEKVNGLRYKNRTSGVEHNVALEGVFVQIGLVPNTEWLDGVVERNRFGEVIVDARGHTSV
PGVFAAGDSTTVPFKQIIIATGEGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgatgtcaaggcccaactgaagtcctacctcgaacgcctcgtgcagccc
atcgagctggtcgcctcgatcgacgacagcgagggctctcgcgacatgatggacctgctg
cgcgatgtcgccgggcagtccagcctgatcgcgctcaacgagcagcgcgacgatgccgag
cgcaagccgtcgttcctgatccgccgtaccggcaccgatgtcggtgtccgcttcgcggcc
atcccgacgggccacgagttcacctcgctcgtgctggcgttgctgcaggtgggcggctac
gcccccaagctcgatgacgacaccatcgaacagattcgcaatctcgacggcgatttccgc
ttcgagacctatatgtccctgacgtgccagaactgcccggacgtggtccaggcgctgaac
gtcatgtcggtgatcaacccgcgcatccagcacgtcgctatcgacggcgggctgttccag
gacgaagtggaagcgcgcaagatcatggccgtgccgaccctcttcatgaacggggaagtc
ttcagccagggccgcatgggcgtggaagagattctcgccaagatcgacaccggcgccgcc
gagcgcgacgccgagaagctcaacgcccgcgcaccgtacgacgtgctgatcgtcggcggc
ggcccggcgggcgcggcagcggccgtgtacgcggcgcgcaagggcgtgcgcaccggcgtg
gtggccgagcgcttcggcggccaggtgctggacacgctggccatcgagaacttcgtctcc
gtgcaggagaccgaagggccgaagttcgccgctgcgctggagcagcacgtgcgccagtac
ggcgtcgacatcatgaacgcgcagcgcgccgtcaagctcgtgccggccgacgagccgggc
ggtttgtccgaggtgacgctcgccaacggcgcggtgctcaagggccgctcgatcatcctg
tcgaccggcgcgcgctggcgcaacgtcaacgtgccgggtgaacaggaataccgtaaccgc
ggcgtggcgtactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggccgtg
atcggcggcggtaactccggcgtggaagccgcgatcgacctggcgggcatcgtcagccac
gtcacgctgctcgagttcggcgaccagctcaaggccgacgccgtactggtgcgcaagctg
gagagcctgcccaacgcgaccatcctcaccaacgcgcagaccaccgagatcaccggcaac
ggcgaaaaggtcaacggcctgcgctacaagaaccgcaccagcggcgtcgagcacaacgtc
gcgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcgacggt
gtggtggagcgcaaccgcttcggcgaggtcattgtcgacgcgcgcggccacaccagcgtg
ccgggcgtgttcgcggcgggggattcgaccaccgtgccgttcaagcagatcatcatcgcc
acgggcgagggcgctaaggccgcactgtccgccttcgatcacctgatccgggtgccgctg
gccgaagccgcctga

DBGET integrated database retrieval system