KEGG   Ralstonia solanacearum Po82: RSPO_m01085
Entry
RSPO_m01085       CDS       T02005                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsn02044]
    RSPO_m01085
Secretion system [BR:rsn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSPO_m01085
SSDB
Motif
Pfam: ImpA_N T6SS_VasJ
Other DBs
NCBI-ProteinID: AEG71721
UniProt: F6G9D3
LinkDB
Position
megaplasmid:1219458..1220537
AA seq 359 aa
MATLQLDQLLAPLSGPTPCGEDMLFSSEFDAIQDARRFDDPSLDQGEWVTEIKEADWRTV
VAESTALLQTRTKDLRLAAWLTEALSKERGFTGLREGYELIAGLCEQYWEHLFPLPEPDD
PEARTGSMVWLAVRSSQLVREVPLVDAGKGGFNYIDWEVATNLVEAIRRDPDQADELSRG
KVTQEQFESARRATPAAFYTTLHSDVVGCGAALLRLESVLDARAADHAPSFRAAREALQA
VRALVERFGGRTETKPNANGAKTPVVPQQTAQPVAEAEPDTVIGPIRTRAQALNQLREVA
EFFRQTEPHSPVAYLAARAAKWGDMPLHAWLRTVVKDDATLSQIEELLGLGDPPVDSAS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcaaccctccagctcgaccagcttctcgccccgctctccggccccacgccttgcggc
gaggacatgctgttctcctccgaattcgacgccatccaggacgcgcgccgcttcgacgac
ccctcgctcgaccagggcgagtgggtgaccgagatcaaggaagcggactggcgcaccgtc
gtcgcggaaagcacggcgctgctgcagacgcgcaccaaagacctgcgcctggccgcgtgg
ctgaccgaggccctgtccaaggagcgcggctttaccggcctgcgcgagggctacgagctg
atcgcgggcttgtgcgagcagtactgggagcacctcttcccgctgcccgagccggacgac
cccgaagcgcgcaccggtagcatggtgtggctggcggtgcgctccagccaactggtccgc
gaggtgccgctggtggatgcgggcaagggcggcttcaactatatcgattgggaagtcgcc
accaacctggtcgaggcgatccggcgtgatccggaccaggcggatgagctgtcgcgcggc
aaggtcacgcaggagcagttcgagtcggcgcggcgcgccacgccggcggcgttctacacg
accttgcacagcgacgtggtcggttgcggcgcggcgctgctgcggctggaatccgtgctg
gatgcccgcgccgcggaccacgcgcccagcttccgcgccgcgcgcgaggcgctgcaggcg
gtgcgcgccctggtcgagcgcttcggcggcaggaccgagaccaagccgaatgcgaacggg
gccaagacgcccgtcgtgccgcagcagaccgcccagcccgtcgccgaggccgagcccgac
accgtgatcggcccgatccgcacccgcgcccaggcgctgaaccaactgcgcgaggtggcc
gagttcttccgccagaccgagccgcacagcccggtggcttaccttgccgcgcgcgcggcc
aagtggggcgacatgccgctgcatgcctggctgcgcacggtggtcaaggacgatgcgacg
ctgtcgcagatcgaggaactgttggggttgggcgatccgcccgtcgacagcgcgagctga

DBGET integrated database retrieval system