KEGG   Ralstonia solanacearum GMI1000: RSc0327Help
Entry
RSc0327           CDS       T00071                                 

Gene name
dac
Definition
(GenBank) probable penicillin-binding (d-alanyl-d-alanine carboxypeptidase) transmembrane protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00550  Peptidoglycan biosynthesis
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSc0327 (dac)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rso01002]
    RSc0327 (dac)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
    RSc0327 (dac)
Enzymes [BR:rso01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RSc0327 (dac)
Peptidases [BR:rso01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   RSc0327 (dac)
Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   RSc0327 (dac)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 DNA_methylase
Motif
Other DBs
NCBI-ProteinID: CAD13855
UniProt: Q8Y2K8
LinkDB All DBs
Position
complement(358458..359651)
Genome map
AA seq 397 aa AA seqDB search
MQTRIPSRALPSAAVTLVAAAVLAAAAPALAQPVPAPQVAARAWMLTDVTSGQVLGGGNV
DERIEPASLTKLMTAYLAVEAVRDGKLKYDQMLTPTETVRSVKTDESRMFLQPGKPVSVR
DLLQGLIVQSGNDAALVLAEAVGGTETNFVMLMNREAERLGMKGTHFMNAAGLPDPNHYT
TARDLSILTAALIRDFPEDYKFYSQKEFTYNNIKQPNRNRLLWIDPTVDGVKTGHTKSAG
YCLITSAKRPLPDVPNASRRLLSVMIGTKSEQVRTQESLKVLNYGYQFFDTLRLYEAKQA
LQTPDVYKGQAKTVKLGVAEDKWITVPKGSGGRLKPVLERKEPLIAPIAQGQQLGTVKVM
DGATVVQEFPVVALEAVPEAGFIGRTIDSIKLWFKKK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccgtatcccctcccgagcccttccctccgccgccgtgacgctcgtcgcggca
gccgtgcttgccgcggcagcgccggcactggcgcagcccgtcccggcgccgcaggtcgca
gcccgcgcatggatgctgaccgatgtgacgagcggccaggtgctgggcggcggcaacgta
gacgagcgcatcgagcccgcctcgctgaccaagctgatgaccgcgtacctcgccgtcgag
gccgtgcgcgacggcaagctcaagtacgaccagatgctcaccccgaccgagaccgtgcgc
agcgtcaagaccgacgagtcgcgcatgttcctgcagcccggcaagcccgtctcggtacgc
gacctgctgcagggcctgatcgtgcagtcgggcaatgacgcggcgctggtgctggccgag
gccgtgggcggcaccgagaccaacttcgtgatgctgatgaaccgcgaggccgaacgcctg
ggcatgaagggcacgcacttcatgaacgccgccggcctgcccgacccgaaccactacacc
acggcgcgcgacctgtcgatcctgaccgcggcgctgatccgcgatttccccgaggactac
aagttctattcgcagaaggaattcacctataacaacatcaagcagcccaaccgcaaccgg
ctgctgtggatcgacccgacggtcgacggcgtcaagaccggccacaccaagtcggcgggc
tattgcctgatcacctcggccaagcgcccgctgcccgacgtgccgaacgcgagccgccgc
ctgctgtcggtgatgatcggcaccaagagcgaacaggtccgcacgcaggagagcctgaag
gtgctcaactacggctaccagttcttcgacaccctgcgcctgtacgaagccaagcaggcg
ctgcagacgcccgacgtctacaagggccaggccaagaccgtcaagctcggcgtggcggaa
gacaagtggatcacggtgcccaagggctcgggcggccgcctcaagccggtgctcgagcgc
aaggagccgctgatcgccccgatcgcgcagggccagcagctgggcacggtcaaggtgatg
gacggcgcgaccgtggtgcaggagttcccggtggtggcgctggaagccgtgcccgaagcc
ggattcatcggccgcaccatcgattcgatcaagctgtggttcaagaagaagtaa

DBGET integrated database retrieval system