KEGG   Ralstonia solanacearum GMI1000: RSc0584Help
Entry
RSc0584           CDS       T00071                                 

Definition
(GenBank) probable d-alanyl-d-alanine carboxypeptidase signal peptide protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSc0584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rso01002]
    RSc0584
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
    RSc0584
Enzymes [BR:rso01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RSc0584
   3.4.21  Serine endopeptidases
    3.4.21.-  
     RSc0584
Peptidases and inhibitors [BR:rso01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   RSc0584
Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   RSc0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 CENP-F_C_Rb_bdg
Motif
Other DBs
NCBI-ProteinID: CAD14114
UniProt: Q8Y1V5
LinkDB All DBs
Position
complement(627215..628759)
Genome map
AA seq 514 aa AA seqDB search
MARIIRLTRLLRLSRCAVACAALLAFTAAPLAQARKPARAHAAPAATVAQKRQAAHNPAG
LPANVALAFARAHIPLDAVSVFVIRTGTATPILQWNADAGMNPASTMKLLTTFAGLDLLG
PDFRWKTSAYADRPPAGGVLSGNLYLRGQGDPKLIPEELIKLVTDVRRAGVDELAGNIVL
DRSYFENGLSDAPPLDGDTGRAYNVAPDALLYAFKTLTFTLAPDAATGAVNVDVSPPLAQ
LQVDNQLHVTHGNCGDWRSHANFDIATQADGTVRASFDGRYAGACGERIFNVAALTHADF
IWGGFLALWRQAGGTFRATPGLREGKVPHPAVLLATHYGPTLAEVVHDIDKYSNNVMARQ
LFLTIGAEIGRKPASVQQSADIISRWLARQNLSMPELVLENGSGLSRIERISARNLGRLL
QQADANPNGAILRDALPVVGVDGTMRNRLTRAGVAGNAEIKTGTLNDVRAIAGYVEGEGG
QRYVVVSMINHPSAGGGQAAHDALLQWIYQGAPQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaatcatccgcctgacccgtttgctccgcctgtcgcgctgtgccgttgcctgc
gcggccctcctcgccttcaccgccgcaccgctggcgcaggccagaaaacccgcccgcgcc
catgccgctcccgccgccaccgtcgcccagaagcggcaggccgcgcacaatccggccggg
ctgcccgccaatgtggcgctggcgttcgcgcgggcgcatatcccgctcgatgcggtcagc
gtgttcgtcatccgcaccggcaccgccacgcccatcctgcaatggaacgccgacgccggc
atgaatccggcctcgaccatgaagctgctgaccaccttcgccggcctcgacctgctgggc
cccgatttccgctggaagacctccgcctacgccgacaggcctccggcgggcggcgtgctc
agcggcaacctctacctgcgcggccagggcgatccgaagctgattcccgaagagctgatc
aagctggtcaccgacgtgcgccgcgccggcgtggacgagctggccggcaacatcgtgctg
gaccgctcctatttcgagaacggcctgtccgacgcgccgccgctggacggcgacaccggc
cgcgcctacaacgtcgcgcccgatgcgctgctctacgcgttcaagacgctgaccttcacg
ctcgcgcccgacgccgccaccggcgcggtcaacgtcgacgtgtcgccgccgctggcccag
ctgcaggtcgacaaccaactgcacgtgacgcacggcaactgcggcgactggcgctcgcat
gccaatttcgacatcgccacgcaggccgacggcacggtgcgcgccagcttcgacgggcgc
tacgccggcgcctgcggcgagcgcatcttcaatgtcgccgcgctcacccacgccgacttc
atctggggcggcttcctggcgctgtggcggcaggcaggcggcaccttccgcgccacgccg
ggcctgcgcgagggcaaggtgccgcatccggccgtcctgctggcgacgcactacggcccg
accctcgccgaggtcgtgcacgacatcgacaagtattcgaacaacgtgatggcgcgccag
ctgttcctgaccatcggcgccgagatcggccgcaagcccgcgtcggtgcagcaatcggcg
gacatcatcagccgctggctcgcccggcagaacctgtccatgccggagctggtgctggag
aacggctcgggcctctcgcgcatcgagcgcatcagcgcccgcaacctgggccgcctgctg
cagcaggccgatgccaaccccaacggcgccatcctgcgcgacgcgctgccggtggtgggc
gtggacggcaccatgcgcaaccgcctcacgcgcgcgggcgtggccggcaacgccgagatc
aagaccggcacgctcaacgacgtgcgcgccatcgccggctacgtggaaggcgaaggcggc
cagcgctacgtggtggtcagcatgatcaaccaccccagcgccggcggcggccaggccgca
cacgacgccctgctgcaatggatctaccagggggcgccgcaatga

DBGET integrated database retrieval system