KEGG   Ralstonia solanacearum GMI1000: RSc0817Help
Entry
RSc0817           CDS       T00071                                 

Gene name
gstD
Definition
(GenBank) probable glutathione s-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RSc0817 (gstD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rso02000]
    RSc0817 (gstD)
Enzymes [BR:rso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RSc0817 (gstD)
Transporters [BR:rso02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSc0817 (gstD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 Tom37 Minor_tail_Z GST_N_4
Motif
Other DBs
NCBI-ProteinID: CAD14519
UniProt: Q8Y173
LinkDB All DBs
Position
860631..861251
Genome map
AA seq 206 aa AA seqDB search
MKLYYFPGACSLSPHIVAREAGIPLQLVKVDLSTKRTEHGEDFHRISPKGAVPVLELDSG
ERLTEGPAITQYLADLKPESGLVPANGTMARYRLQEWLGWINSELHKSYSPLFNSSTPET
VRQDRKDALHRQYALVEQHLAAHPWLLGERFSAADAYLFTVTNWAGHVGLDLSAFTALAA
FQQRVASRPAVLAALEAEGLLSEAEA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactactttcccggagcctgttcactctcgccgcacatcgtggcgcgcgag
gcgggcatccccctgcagctcgtcaaggtcgacctcagcaccaagcgcacggaacacggt
gaagatttccaccggatcagccccaagggcgccgtgcccgtcctcgaactggacagcggt
gagcggctgaccgaaggcccggcgatcacgcaatacctcgccgacctcaagcccgaaagc
ggcctggttcccgccaacggcaccatggcacgctatcgcttgcaggaatggctgggctgg
atcaactcggaactgcacaagagctactcgccgctgttcaattcgtccacgcctgagacg
gttcggcaggaccgcaaggatgccctgcaccggcagtacgcgctggtggagcagcacctg
gcggcccatccctggctgctgggcgaacgtttctcggcggcagacgcctatctgttcacg
gtcaccaactgggccgggcatgtgggcctcgacctgtcggcattcacggcgctggccgca
ttccagcagcgcgtcgcgtcacggccggccgtgctggctgcgctggaggccgaggggctg
ttgagcgaggcggaggcgtaa

DBGET integrated database retrieval system