KEGG   Ralstonia solanacearum GMI1000: RSc1247Help
Entry
RSc1247           CDS       T00071                                 

Definition
(GenBank) probable sugar phosphate isomerases/epimerases protein
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00562  Inositol phosphate metabolism
rso01100  Metabolic pathways
rso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    RSc1247
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     RSc1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAD14949
UniProt: Q8XZZ8
LinkDB All DBs
Position
1322340..1323281
Genome map
AA seq 313 aa AA seqDB search
MESTDMTMKIGCAPCCWGVDDVRNPHLPPWRRVLSEASLAGYSGIELGPYGYLPLEADVV
RAELDARGLSITAGTIFDDLVSPENLPSLLRQTREICALIRQLPPLPTQAGQRYPAPYLV
VMDWGHPERDYTAGHPERAPRLSDAQWAGMVEHIRQIAEVARGEFGVRAVIHPHAGGYLE
FDDEIDRIVADIPAETAGLCLDTGHLYYSGMDPASWLRRHAARLDYVHFKDIDLPTYRQV
LGERIAFFEACARGVMCPIGQGVLDYPAIKRTLEALGYAGYITIEQERDPRNAGSSLRDV
AASREFLATVGFA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaccgatatgacgatgaaaatcggctgtgcgccctgctgctggggcgtggac
gacgtgaggaatccgcacctgccgccctggcgccgggtgctgtccgaagcgtcgctggcg
ggctactcgggcatcgagctcggaccttatggctatctcccgctggaggcggatgtcgtg
cgggccgaactggatgcgcggggcctgagcatcacggccggcacgatcttcgacgacctg
gtgtcgccggagaatctgccgagcctgctgcgccagacgcgcgagatctgcgcgctgatc
cggcaactgccgccattgccgacccaggccggtcagcgttatcccgcgccgtacctcgtg
gtgatggactgggggcacccggagcgtgattacacggcaggccacccggagcgcgcgccg
cggctgtccgatgcacagtgggcgggcatggtcgaacacatccggcagatcgcggaggtg
gcccgcggcgagttcggcgtgcgcgcggtcatccacccgcatgccggcggctatctcgaa
ttcgacgacgagatcgaccggatcgtcgccgatatccccgccgaaacggccgggctgtgc
ctcgatacggggcacctctattactccggcatggacccggcgagctggctgcgccggcat
gccgcgcgcctcgactacgtgcatttcaaggacatcgatctcccgacgtaccggcaggtg
ctgggcgaacggatcgccttcttcgaggcctgcgcgcgcggcgtgatgtgcccgatcggc
cagggtgtgctggattacccggccatcaagcgcacgctggaagcactgggctacgccggc
tacatcacgatcgagcaggagcgcgatccgcgcaacgccggctccagcctgcgcgatgtg
gcggcgagccgtgaatttctcgccacggtgggttttgcctga

DBGET integrated database retrieval system