KEGG   Ralstonia solanacearum GMI1000: RSc1974Help
Entry
RSc1974           CDS       T00071                                 

Definition
(GenBank) probable atp-binding abc transporter protein
  KO
K09695  lipooligosaccharide transport system ATP-binding protein
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RSc1974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rso02000]
    RSc1974
Transporters [BR:rso02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter
    RSc1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_22 AAA_23 MukB AAA_30
Motif
Other DBs
NCBI-ProteinID: CAD15676
UniProt: Q8XXY9
LinkDB All DBs
Position
2148369..2149334
Genome map
AA seq 321 aa AA seqDB search
MRYEQPPGPGIGSTPILSVEGLRKRYGEQTVVDGLSFSVRRGQCFGLLGPNGAGKTTTLR
MLLGMTMPDAGTLQLCGETIPGHAHRARMRVGVVPQFDNLDPDFTVSENLQIFGRYFGLP
AATIRKRMPGLLEFARLEQKADAPVRALSGGMRRRLTVARSLINDPDVLVMDEPTTGLDP
QARHLIWERLRSLLASGKTILLTTHFMEEAERLCDELCVIDNGRKIAQGKPHELITHEIG
CDVVEVYGDDLPALRTLLAPLAERVEASGETLFCYARDPQPLVATLRSQTETHAMPGLRY
LHRPANLEDVFLRLTGREMRD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatacgagcaaccgcccggcccgggcatcggcagcacgccgatcctcagcgtcgaa
ggactgcgcaagcgctatggcgagcagacggtggtcgacggcctgagcttttcggtccgc
cgcggccagtgcttcggactgctcgggcccaacggcgcaggcaagaccaccacgctgcgc
atgctgctcggcatgacgatgcccgatgcgggcaccctgcagctgtgcggcgaaaccatc
cccggacatgcgcaccgcgcgcgcatgcgcgtgggcgtggtgccgcagttcgacaacctc
gaccccgatttcaccgtctcggaaaacctgcagatcttcggccgctacttcggcctgcct
gccgcgaccatccgcaagcggatgccgggcctgctggaattcgcgcggctcgagcaaaag
gccgacgcgcccgtgcgcgccctgtcgggcgggatgcggcggcggctgacggtcgcgcgc
tcgctgatcaacgaccccgatgtcctggtgatggacgagcccaccaccgggctcgacccg
caggcgcgccacctgatctgggaacgcctgcgctcgctgctggcctccggcaagaccatc
ctgctgaccacgcacttcatggaagaggccgagcgcctctgcgacgaactgtgcgtgatc
gacaacggccgcaagatcgcccaaggcaagccgcacgagctgatcacccatgagatcggc
tgtgatgtcgtggaggtctacggtgacgacctgcccgcgctgcgcacgctgctcgccccc
ctggccgagcgcgtcgaagccagcggcgaaacgctgttctgctacgcccgcgatccgcag
ccgctggtggccaccctgcgctcgcagaccgagacgcacgccatgcccggcctgcgctac
ctgcaccgcccggccaacctcgaagatgtgttcctgcgcctgaccggccgcgagatgcgc
gactga

DBGET integrated database retrieval system