KEGG   Ralstonia solanacearum GMI1000: RSc2368Help
Entry
RSc2368           CDS       T00071                                 

Gene name
sodC
Definition
(GenBank) probable superoxide dismutase cu-zn precursor protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RSc2368 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAD16075
UniProt: Q8XWV2
LinkDB All DBs
Position
complement(2572296..2572844)
Genome map
AA seq 182 aa AA seqDB search
MKQLVIGLAAIGLMAGCASNAGTGASTGAPAAGTSALATLAPKSGSNVQGTIKLLQQGDS
RVAMAVDIAGLPPNGMFGFHVHEKGDCSSPDGMSAGGHFNPTGQPHGDPRSGPHHAGDIP
MLQSDASGKAVGSIVLNGVTLTPGATSLVGRAVIVHAGMDDYKTQPTGNSGGRVACGVIV
AN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgtgatcggacttgccgcgatcggcctgatggccggctgcgcttcgaat
gccggcaccggcgccagcaccggcgcacccgccgccggcacctcggctttggccacgctg
gcgcccaagagcggcagcaacgtgcaaggcaccatcaagctgctgcagcaaggcgacagc
cgggttgcgatggcggtcgacattgccggcctgccgcccaacggcatgttcggcttccat
gtacacgagaagggcgactgctcctcgccggacggcatgagcgcgggcggccacttcaac
ccgaccggccagccgcacggcgatccgcgctccggcccgcaccatgccggcgacatcccg
atgctgcagtccgatgccagcggcaaggccgtcggctcgatcgtcctgaacggcgtcacg
ctcacgcccggcgccaccagcctggtcggccgcgcggtgatcgtccatgcgggcatggac
gactacaagacccagccgaccggcaactccggcgggcgcgtcgcttgcggcgtgatcgtg
gcgaactga

DBGET integrated database retrieval system